KEGG   Pongo abelii (Sumatran orangutan): 100451029
Entry
100451029         CDS       T01416                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7 isoform X1
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04540  Gap junction
pon04657  IL-17 signaling pathway
pon04722  Neurotrophin signaling pathway
pon04912  GnRH signaling pathway
pon04921  Oxytocin signaling pathway
pon05206  MicroRNAs in cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100451029 (MAPK7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100451029 (MAPK7)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100451029 (MAPK7)
  09152 Endocrine system
   04912 GnRH signaling pathway
    100451029 (MAPK7)
   04921 Oxytocin signaling pathway
    100451029 (MAPK7)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100451029 (MAPK7)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451029 (MAPK7)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100451029 (MAPK7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100451029 (MAPK7)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100451029 (MAPK7)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100451029 (MAPK7)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kdo Kinase-like APH Rrn6
Other DBs
NCBI-GeneID: 100451029
NCBI-ProteinID: XP_002827174
UniProt: A0A2J8RCA8
LinkDB
Position
17
AA seq 814 aa
MAEPLKEEDGEDGSAEPPGPVKAEPAHTAASVAAKNLALLKARSFDVTFDVGDEYEIIET
IGNGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAIKDI
LRPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQVIH
RDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLHEYT
QAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMMVLGTPSPAVIQAVGAERVRAYIQS
LPPRQPVPWETVYPGADRQALSLLGRMLRFEPSARISAAAALRHPFLAKYHDPDDEPDCA
PPFDFAFDREALTRERIKEAIVAEIEDFHARREGIRQQIRFQPSLQPVASEPGCPDVEMP
SPWAPSGDCAMESPPPAPPPCPGPAPDTIDLTLQPPPPASEPTPPKKEGAISDNTKAALK
AALLKSLRSRLRDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRRQERER
KERGAGASGGPSTDPLAGLVLSDNDRSLLERWTRMARPPAPAPTSVPAPAPVPTPTPAQP
TSPPPGPVAQPTGPQPQPAGSTSGPVPQPACPPPGPAPHPTGTPGPIPVPAPPQIATSTS
LLAPQSLVPPPGLPGSSTPGVLPYFPPGLPPPDAAGAPQSSMSESPDVNLVTQQLSKSQV
EDPLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMGVADAPQDGQADSASLSASLLADWL
EGHGMNPADIESLQREIQMDSPMLLADLPDLQDP
NT seq 2445 nt   +upstreamnt  +downstreamnt
atggccgagcctctgaaggaggaagacggcgaggacggctctgcggagccccccgggccc
gtgaaggccgaacccgcccacaccgctgcctctgtagcggccaagaacctggccctgctt
aaagcccgctccttcgatgtgacctttgacgtgggcgacgagtacgagatcatcgagacc
ataggcaacggggcctatggagtggtgtcctccgcccgccgccgcctcaccggccagcag
gtggccatcaagaagatccctaatgccttcgatgtggtgaccaatgccaagcggaccctc
agggagctgaagatcctcaagcactttaagcacgacaacatcatcgccatcaaggacatc
ctgaggcccactgtgccctatggcgaattcaaatctgtctacgtggtcctggacctgatg
gaaagcgacctccaccagatcatccactcctcacagcccctcacactggaacacgtgcgc
tacttcttgtaccaactgctgcggggcctgaagtacatgcactcggctcaggtcatccac
cgtgacctcaagccttccaacctattggtgaatgagaactgtgagctgaagattggtgac
tttggtatggctcgtggcctgtgcacctcgcccgctgaacatcagtacttcatgactgag
tatgtggccacgcgctggtaccgtgcacccgagctcatgctctctttgcatgagtataca
caggctattgacctctggtctgtgggctgcatctttggtgagatgctggcccggcgccag
ctcttcccaggcaaaaactacgtacaccagctacagctcatcatgatggtgctgggtacc
ccatcaccagctgtgattcaggctgtgggggctgagagggtgcgggcctatatccagagc
ttgccaccacgccagcctgtgccctgggagacagtgtacccaggtgccgaccgccaggcc
ctatcactgctgggtcgcatgctgcgttttgagcccagcgcccgcatctcagcagctgct
gcccttcgccaccctttcctggccaagtaccatgatcctgatgatgagcctgactgtgcc
ccgccctttgactttgcttttgaccgtgaagccctcactcgggagcgcattaaggaggcc
attgtggctgaaattgaggacttccatgcaaggcgtgagggcatccgccaacagatccgc
ttccagccttctctacagcctgtggctagtgagcctggctgtccagatgttgaaatgccc
agtccctgggctcccagtggggactgtgccatggagtctccaccaccagccccgccaccg
tgccccggccctgcacctgacaccattgatctgaccctgcagccacccccaccagccagt
gagcctaccccaccgaagaaagagggtgccatctcagacaatactaaggctgcccttaaa
gctgccctgctcaagtctttgaggagccggctcagagatggccccagcgcacccctggag
gctcctgagcctcggaagccggtgacagcccaggagcgccagcgggagcgggaggagaag
cggcggaggcggcaagaacgagccaaggagcgggagaaacggcggcaggagcgggaacga
aaggaacggggggctggggcctctgggggcccctccactgaccccttggctggactagtg
ctcagtgacaatgacagaagcctgttggaacgctggactcgaatggcccggcccccagcc
ccagcccccacctctgtgccggcccctgccccagtgccaacgccaaccccagcccaacct
accagtcctcctcctggccctgtagcccagcccactggcccgcaaccacaacctgcgggc
tctacctctggccctgtaccccagcctgcctgcccaccccctggccctgcaccccacccc
actggcactcctgggcccatccctgtccctgcgccaccccagattgccacctccaccagc
ctcctggctccccagtcccttgtgccaccccctgggctgcctggctccagcaccccagga
gttttgccttacttcccacctggcctgccacctccagacgccgcgggagcccctcagtct
tccatgtcagagtcacctgatgtcaatcttgtgacccagcagctatctaagtcacaggtg
gaggacccactgccccccgtgttctcaggcacaccaaagggcagtggggctggctacggt
gttggctttgacctggaggaattcttaaaccagtctttcgacatgggcgtggctgatgcg
ccacaggatggccaggcagattcagcctctctctcagcctccctgcttgctgactggctc
gaaggccatggcatgaaccctgccgatattgagtccctgcagcgtgagatccagatggac
tccccaatgctgctggctgacctgcctgacctccaggacccctga

DBGET integrated database retrieval system