KEGG   Pongo abelii (Sumatran orangutan): 100451032
Entry
100451032         CDS       T01416                                 

Gene name
CXCR4
Definition
(RefSeq) C-X-C chemokine receptor type 4
  KO
K04189  C-X-C chemokine receptor type 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04062  Chemokine signaling pathway
pon04144  Endocytosis
pon04360  Axon guidance
pon04670  Leukocyte transendothelial migration
pon04672  Intestinal immune network for IgA production
pon04810  Regulation of actin cytoskeleton
pon05163  Human cytomegalovirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100451032 (CXCR4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100451032 (CXCR4)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100451032 (CXCR4)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100451032 (CXCR4)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100451032 (CXCR4)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100451032 (CXCR4)
   04672 Intestinal immune network for IgA production
    100451032 (CXCR4)
   04062 Chemokine signaling pathway
    100451032 (CXCR4)
  09158 Development and regeneration
   04360 Axon guidance
    100451032 (CXCR4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451032 (CXCR4)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100451032 (CXCR4)
   05163 Human cytomegalovirus infection
    100451032 (CXCR4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100451032 (CXCR4)
   04050 Cytokine receptors [BR:pon04050]
    100451032 (CXCR4)
   04090 CD molecules [BR:pon04090]
    100451032 (CXCR4)
G protein-coupled receptors [BR:pon04030]
 Rhodopsin family
  Chemokine
   CXC Chemokine
    100451032 (CXCR4)
Cytokine receptors [BR:pon04050]
 Chemokine receptors
  CXC Chemokine
   100451032 (CXCR4)
CD molecules [BR:pon04090]
 Proteins
  100451032 (CXCR4)
SSDB
Motif
Pfam: 7tm_1 CXCR4_N 7TM_GPCR_Srsx Cybc1_Eros
Other DBs
NCBI-GeneID: 100451032
NCBI-ProteinID: XP_002812491
Ensembl: ENSPPYG00000012823
UniProt: A0A663D9W7 H2P7G7
LinkDB
Position
2B
AA seq 352 aa
MDGISIYTSDNYTEEMGSGDYDSIKEPCFREENANFNKIFLPTIYSIIFLTGIVGNGLVI
LVMGYQKKLRSMTDKYRLHLSVADLLFVITLPFWAVDAVANWYFGNFLCKAVHVIYTVNL
YSSVLILAFISLDRYLAIVHATNSQRPRKLLAEKVVYVGVWIPALLLTIPDFIFANVSEA
DDRYICDRFYPNDLWVVVFQFQHIMVGLILPGIVILSCYCIIISKLSHSKGHQKRKALKT
TVILILAFFACWLPYYIGISIDSFILLEIIKQGCEFENTVHKWISITEALAFFHCCLNPI
LYAFLGAKFKTSAQHALTSVSRGSSLKILSKGKRGGHSSVSTESESSSFHSS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggacgggatcagtatatacacttcagataactacaccgaggaaatgggctcaggggac
tatgactccataaaggaaccctgcttccgtgaagaaaatgctaatttcaataagatcttc
ctgcccaccatctactccatcatcttcttgactggcattgtgggcaatggattggtcatc
ctggtcatgggttaccagaagaaactgagaagcatgacggacaagtacaggctgcacctg
tcagtggccgacctcctctttgtcatcacgcttcccttctgggcagttgatgccgtggca
aactggtactttgggaacttcctatgcaaggcagtccatgtcatctacacagtcaacctc
tacagcagcgtcctcatcctggccttcatcagtctggaccgctacctggccatcgtccac
gccaccaacagtcagaggccaaggaagctgttggctgaaaaggtggtctatgttggcgtc
tggatccctgccctcctgctgactattcccgacttcatctttgccaacgtcagtgaggca
gatgacagatatatctgtgaccgcttctaccccaatgacttgtgggtggttgtgttccag
tttcagcacatcatggttggccttatcctgcctggtattgtcatcctgtcctgctattgc
attatcatctccaagctgtcacactccaagggccaccagaagcgcaaggccctcaagacc
acagtcatcctcatcctggctttctttgcctgctggctgccttactacattgggatcagc
atcgactccttcatcctcctggaaatcatcaagcaagggtgtgagtttgagaacactgtg
cacaagtggatttccatcaccgaggccctagctttcttccactgttgtctgaaccccatc
ctctatgctttccttggagccaaatttaaaacctctgcccagcacgcactcacctctgtg
agcagagggtccagcctcaagatcctctccaaaggaaagcgaggtggacattcatctgtt
tccactgagtctgagtcttcaagttttcactccagctaa

DBGET integrated database retrieval system