KEGG   Pongo abelii (Sumatran orangutan): 100451342
Entry
100451342         CDS       T01416                                 

Gene name
GRM1
Definition
(RefSeq) metabotropic glutamate receptor 1 isoform X3
  KO
K04603  metabotropic glutamate receptor 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon04730  Long-term depression
pon04742  Taste transduction
pon04915  Estrogen signaling pathway
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100451342 (GRM1)
   04020 Calcium signaling pathway
    100451342 (GRM1)
   04072 Phospholipase D signaling pathway
    100451342 (GRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100451342 (GRM1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100451342 (GRM1)
 09150 Organismal Systems
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100451342 (GRM1)
  09156 Nervous system
   04724 Glutamatergic synapse
    100451342 (GRM1)
   04720 Long-term potentiation
    100451342 (GRM1)
   04730 Long-term depression
    100451342 (GRM1)
   04723 Retrograde endocannabinoid signaling
    100451342 (GRM1)
  09157 Sensory system
   04742 Taste transduction
    100451342 (GRM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05017 Spinocerebellar ataxia
    100451342 (GRM1)
   05022 Pathways of neurodegeneration - multiple diseases
    100451342 (GRM1)
Protein phosphatases and associated proteins [BR:pon01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100451342 (GRM1)
G protein-coupled receptors [BR:pon04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100451342 (GRM1)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 NCD3G DUF2318 DUF5438 AAA_34
Other DBs
NCBI-GeneID: 100451342
NCBI-ProteinID: XP_003776985
LinkDB
Position
6
AA seq 906 aa
MVGLLLFFFPAIFLEVSLLPRSPGRKVLLAGASSQRSVARMDGDVIIGALFSVHHQPPAE
KVPERKCGEIREQYGIQRVEAMFHTLDKINADPVLLPNITLGSEIRDSCWHSSVALEQSI
EFIRDSLISIRDEKDGINRCLPDGQSLPPGRTKKPIAGVIGPGSSSVAIQVQNLLQLFDI
PQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESG
MDAFKELAAQEGLCIAHSDKIYSNAGEKSFDRLLRKLRERLPKARVVVCFCEGMTVRGLL
SAMRRLGVVGEFSLIGSDGWADRDEVIEGYEVEANGGITIKLQSPEVRSFDDYFLKLRLD
TNTRNPWFPEFWQHRFQCRLPGHLLENPNFKRICTGNESLEENYVQDSKMGFVINAIYAM
AHGLQNMHHALCPGHVGLCDAMKPIDGSKLLDFLIKSSFIGVSGEEVWFDEKGDAPGRYD
IMNLQYTEANRYDYVHVGTWHEGVLNIDDYKIQMNKSGVVRSVCSEPCLKGQIKVIRKGE
VSCCWICTACKENEYVQDEFTCKACDLGWWPNAVLTGCEPIPVRYLEWSNIESIIAIAFS
CLGILVTLFVTLIFVLYRDTPVVKSSSRELCYIILAGIFLGYVCPFTLIAKPTTTSCYLQ
RLLVGLSSAMCYSALVTKTNRIARILAGSKKKICTRKPRFMSAWAQVIIASILISVQLTL
VVTLIIMEPPMPILSYPSIKEVYLICNTSNLGVVAPLGYNGLLIMSCTYYAFKTRNVPAN
FNEAKYIAFTMYTTCIIWLAFVPIYFGSNYKIITTCFAVSLSVTVALGCMFTPKMYIIIA
KPERNVRSAFTTSDVVRMHVGDGKLPCRSNTFLNIFRRKKAGAGNAKKRQPEFSPTSQCP
SAHVQL
NT seq 2721 nt   +upstreamnt  +downstreamnt
atggtcgggctcctcttgttctttttcccagcgatctttttggaggtgtcccttctcccc
agaagccccggcaggaaagtgttgctggcaggagcgtcgtctcagcgctcggtggccaga
atggacggagatgtcatcattggagccctcttctcagtccatcaccagcctccggccgag
aaagtgcccgagaggaagtgtggggagatcagggagcagtatggcatccagagggtggag
gccatgttccacacgttggataagatcaacgcggacccggtcctcctgcccaacatcacc
ctgggcagtgagatccgggactcctgctggcactcttccgtggctctggaacagagcatt
gagttcattagggactctctgatttccattcgagatgagaaggatgggatcaaccggtgc
ctgcctgatggccagtccctccccccaggcaggactaagaaacccattgcgggagtgatc
ggtcccggctccagctctgtagccattcaagtgcagaacctgctccagctcttcgacatc
ccccagatcgcttattcagccacaagcatcgacctgagtgacaaaactttgtacaaatac
ttcctgagggttgtcccttctgacactttgcaggcaagggccatgcttgacatagtcaaa
cgttacaattggacctatgtctctgcagtccacacggaagggaattatggggagagcgga
atggacgctttcaaagagctggctgcccaggaaggcctctgcatcgcccattctgacaaa
atctacagcaacgctggggagaagagctttgaccgactcttgcgcaaactccgagagagg
cttcccaaggccagagtggtggtctgcttctgtgaaggcatgacagtgcgaggactcctg
agcgccatgcggcgccttggcgtcgtgggcgagttctcactcattggaagtgatggatgg
gcagacagagatgaagtcattgaaggttatgaggtggaagccaacgggggaatcacgata
aagctgcagtctccagaggtcaggtcatttgatgattatttcctgaaactgaggctggac
actaacacgaggaatccctggttccctgagttctggcaacatcggttccagtgccgcctt
ccaggacaccttctggaaaatcccaactttaaacgaatctgcacaggcaatgaaagctta
gaagaaaactatgtccaggacagtaagatggggtttgtcatcaatgccatctatgccatg
gcacatgggctgcagaacatgcaccatgccctctgccctggccacgtgggcctctgcgat
gccatgaagcccatcgacggcagcaagctcctggacttccttatcaagtcctcattcatc
ggagtatctggagaagaggtgtggtttgatgagaaaggagatgctcctggaaggtatgat
atcatgaatctgcagtacactgaagctaatcgctatgactatgtgcacgttggaacctgg
catgaaggagtgctgaacattgatgattacaaaatccagatgaacaagagtggagtggtg
cggtctgtgtgcagtgagccttgcttaaagggccagattaaggttatacgaaaaggagaa
gtgagctgctgctggatttgcacggcctgcaaagagaatgaatatgtgcaagatgagttc
acctgcaaagcttgtgacttgggatggtggcccaatgcagttctaacaggctgtgagccc
attcctgtgcgctatcttgagtggagcaacatcgaatccattatagccatcgccttttca
tgcctgggaatccttgttaccttgtttgtcaccctaatctttgtactgtaccgggacaca
ccagtggtcaaatcctccagtcgggagctctgctacatcatcctagctggcatcttcctt
ggttatgtgtgcccattcactctcattgccaaacctactaccacttcctgctacctccag
cgcctcttggttggcctctcctctgcgatgtgctactctgctttagtgactaaaaccaat
cgcattgcacgcatcctggctggcagcaagaagaagatctgcacccggaagcccaggttc
atgagtgcctgggctcaggtgatcattgcctcaattctgattagtgtgcaactaaccctg
gtggtaaccctgatcatcatggaaccccctatgcccattctgtcctacccaagtatcaag
gaagtctaccttatctgcaataccagcaacctgggtgtggtggcccctttgggctacaat
ggactcctcatcatgagctgtacctactatgccttcaagacccgcaacgtgcccgccaac
ttcaatgaggccaaatatatcgccttcaccatgtacaccacctgtatcatctggctagct
tttgtgcccatttactttgggagcaactacaagatcatcacaacttgctttgcagtgagt
ctcagtgtaacagtggctctggggtgcatgttcactcccaagatgtacatcattattgcc
aagcctgagaggaatgtccgcagtgccttcaccacctctgatgttgtccgcatgcatgtt
ggcgatggcaagctgccctgccgctccaacactttcctcaacatcttccgaagaaagaag
gcaggggcagggaatgccaagaagaggcagccagaattctcgcccaccagccaatgtccg
tcggcacatgtgcagctttga

KEGG   Pongo abelii (Sumatran orangutan): 100452002
Entry
100452002         CDS       T01416                                 

Gene name
GRM5
Definition
(RefSeq) metabotropic glutamate receptor 5 isoform X1
  KO
K04604  metabotropic glutamate receptor 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04540  Gap junction
pon04720  Long-term potentiation
pon04723  Retrograde endocannabinoid signaling
pon04724  Glutamatergic synapse
pon05010  Alzheimer disease
pon05016  Huntington disease
pon05022  Pathways of neurodegeneration - multiple diseases
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    100452002 (GRM5)
   04072 Phospholipase D signaling pathway
    100452002 (GRM5)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100452002 (GRM5)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    100452002 (GRM5)
 09150 Organismal Systems
  09156 Nervous system
   04724 Glutamatergic synapse
    100452002 (GRM5)
   04720 Long-term potentiation
    100452002 (GRM5)
   04723 Retrograde endocannabinoid signaling
    100452002 (GRM5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452002 (GRM5)
   05016 Huntington disease
    100452002 (GRM5)
   05022 Pathways of neurodegeneration - multiple diseases
    100452002 (GRM5)
G protein-coupled receptors [BR:pon04030]
 Metabotropic glutamate receptor family
  Glutamate (metabotropic)
   100452002 (GRM5)
SSDB
Motif
Pfam: ANF_receptor 7tm_3 GluR_Homer-bdg NCD3G Peripla_BP_6 DUF5438
Other DBs
NCBI-GeneID: 100452002
NCBI-ProteinID: XP_024111058
LinkDB
Position
11
AA seq 1210 aa
MVLLLILSVLLLKEDVRGSAQSSERRVVAHMPGDIIIGALFSVHHQPTVDKVHERKCGAV
REQYGIQRVEAMLHTLERINSDPTLLPNITLGCEIRDSCWHSAVALEQSIEFIRDSLISS
EEEEGLVRCVDGSSSSFRSKKPIVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLS
DKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKDMSAKEGI
CIAHSYKIYSNAGEQSFDKLLKKLTSHLPKARVVACFCEGMTVRGLLMAMRRLGLAGEFL
LLGSDGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQ
HRFQCRLEGFPQENSKYNKTCNSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCP
GYAGLCDAMKPIDGRKLLESLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFD
YINVGSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKEN
EYVFDEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVV
FIIYRDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYS
ALVTKTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIM
HDYPSIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYT
TCIIWLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTS
TVVRMHVGDGKSSSAASRSSSLVNLWKRRGSSGETLRYKDRRLAQHKSEIECFTPKGSMG
NGGRATMSSSNGKSVTWAQNEKSSRGQHLWQRLSIHINKKENPNQTAVIKPFPKSTESRG
LGAGAGGSVGGVGATGGAGCAGAGPGGPESPDAGPKALYDVAEAEEHFPAPARPRSPSPI
STLSHRAGSASRTDDDVPSLHSEPAARSSSSQGSLMEQISSVVTRFTANISELNSMMLST
AAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQPLPAIEVTGGAQPAAGAQAPGDAARE
SPAAGPEAAAAKPDLEELVALTPPSPFRDSVDSGSTTPNSPVSESALCIPSSPKYDTLII
RDYTQSSSSL
NT seq 3633 nt   +upstreamnt  +downstreamnt
atggtccttctgttgatcctgtcagtcttacttttgaaagaagatgtccgtgggagtgca
cagtccagtgagaggagggtggtggctcacatgccgggtgacatcattattggagctctc
ttttctgttcatcaccagcctactgtggacaaagttcatgagaggaagtgtggggcagtc
cgtgaacagtatggcattcagagagtggaggccatgctgcataccctggaaaggataaat
tcagaccccacactcttgcccaacatcacactgggctgtgagataagggattcctgctgg
cattcggctgtggccctagagcagagcattgagttcataagagattccctcatttcttca
gaagaggaagagggcttggtgcgctgtgtggatggctcctcctcttccttccgctccaag
aagcccatagtaggggtcattgggcctggctccagttctgtagccattcaggtccagaat
ttgctccagcttttcaacatacctcagattgcttactcagcaaccagcatggatctgagt
gacaagactctgttcaaatatttcatgagggttgtgccttcagatgctcagcaagcaagg
gccatggtggacatagtgaagaggtacaactggacctatgtatcagccgtgcacacagaa
ggcaactatggagaaagtgggatggaagccttcaaagatatgtcagcgaaggaagggatt
tgcatcgcccactcttacaagatatacagtaatgcaggggagcagagctttgataagctg
ctgaagaagctcacaagtcacttgcccaaggcccgggtggtggcctgcttctgtgagggc
atgacggtgagaggtctgctgatggccatgaggcgcctgggtctagcgggagaatttctg
cttctgggcagtgatggctgggctgacaggtatgatgtgacagatggatatcagcgagaa
gctgttggtggcatcacaatcaaactccaatctcccgatgtcaagtggtttgatgattat
tatctgaagctccggccagaaacaaaccaccgaaacccttggtttcaagaattttggcag
catcgttttcagtgccgactggaagggtttccacaggagaacagcaaatacaacaagact
tgcaatagttctctgactctgaaaacacatcatgttcaggattccaaaatgggatttgtg
atcaacgccatctattcgatggcctacgggctccacaacatgcagatgtccctctgccca
ggctatgcaggactctgtgatgccatgaagccaattgatggacggaaacttttggagtcc
ctgatgaaaaccaattttactggggtttctggagatatgatcctattcgatgagaatgga
gactctccaggaaggtatgaaataatgaatttcaaggaaatgggaaaagattactttgat
tatatcaacgttggaagttgggacaatggagaattaaaaatggatgatgatgaagtatgg
tccaagaaaagcaacatcatcagatctgtatgcagtgaaccatgtgagaaaggccagatc
aaggtgatccgaaagggagaagtcagctgttgttggacctgtacaccttgtaaggagaat
gagtatgtctttgatgagtacacatgcaaggcatgccaactggggtcttggcccactgat
gatctcacaggttgtgatttgatcccagtacagtatcttcgatggggtgaccctgaaccc
attgcagctgtggtgtttgcctgccttggcctcctggccaccctgtttgttaccgtagtc
ttcatcatttaccgtgatacaccagtagtcaagtcctcaagcagggaactctgctacatt
atccttgctggcatctgcctgggctacttatgtaccttctgcctcattgcaaagcccaaa
cagatttactgctaccttcagagaattggcattggtctctccccagccatgagctactca
gcccttgtaacaaagaccaaccgtattgcaaggatcctggctggcagcaagaagaagatc
tgtaccaaaaagcccagattcatgagtgcctgtgcccagctagtgattgctttcattctc
atatgcatccagttgggcatcatcgttgccctctttataatggagcctcctgacataatg
catgactacccaagcattcgagaagtctacctgatctgtaacaccaccaacctaggagtt
gtcactccacttggatacaatggattgttgattttgagctgcaccttctatgcgttcaag
accagaaatgttccagctaacttcaacgaggccaagtatatcgccttcacaatgtacacg
acctgcattatatggctagcttttgtgccaatctactttggcagcaactacaaaatcatc
accatgtgtttctcggttagcctcagtgccacagtggccctaggctgcatgtttgtgccg
aaggtgtacatcatcctggccaaaccagagagaaacgtgcgcagcgccttcaccacatct
accgtggtgcgcatgcatgtaggggatggcaagtcatcctccgcagccagcagatccagc
agcctagtcaacctgtggaagagaaggggctcctctggggaaaccttaaggtacaaagac
aggagactggcccagcacaagtcggaaatagagtgtttcacccccaaagggagtatgggg
aatggtgggagagcaacaatgagcagctccaatggaaaatccgtcacgtgggcccagaat
gagaagagcagccgggggcagcacctgtggcagcgcctgtccatccacatcaacaagaaa
gaaaaccccaaccaaacggccgtcatcaagcccttccccaagagcacggagagccgtggc
ctgggcgctggcgcaggcgggagcgttgggggcgtgggggccacgggcggtgcgggctgc
gcaggcgccggcccaggcgggcccgagtccccagacgccggccccaaggcgctgtatgat
gtggccgaggctgaggagcacttcccggcgcccgcgcggccgcgctcaccgtcgcccatc
agcacgctgagccaccgcgcaggctcggccagccgcacggacgacgacgtgccgtcgctg
cactcggagcccgcggcgcgcagcagctcctcgcagggctccctcatggagcagatcagc
agcgtggtcacccgcttcacggccaacatcagcgagctcaactccatgatgctgtccacc
gcggcccccagccccggcgtcggcgccccgctctgctcgtcctatctgatccccaaagag
atccagttgcccacgaccatgacgacctttgccgaaatccagcctctgccggccatcgag
gtcacgggcggcgcgcagcccgcggcaggggcgcaggcgcctggggacgcggcccgggag
agccccgcggccgggcccgaggctgcggccgccaagccagatctggaggagttggtggct
ctcaccccgccgtcccccttcagagactcggtggactcggggagcacaacccccaactcg
ccagtgtccgagtcggccctctgtatcccgtcgtctcccaaatatgacactcttatcata
agagattacactcagagctcctcgtcgttgtga

DBGET integrated database retrieval system