KEGG   Pongo abelii (Sumatran orangutan): 100451705
Entry
100451705         CDS       T01416                                 

Gene name
IL4
Definition
(RefSeq) interleukin-4 isoform X1
  KO
K05430  interleukin 4
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04672  Intestinal immune network for IgA production
pon05140  Leishmaniasis
pon05200  Pathways in cancer
pon05310  Asthma
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100451705 (IL4)
   04151 PI3K-Akt signaling pathway
    100451705 (IL4)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100451705 (IL4)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100451705 (IL4)
   04660 T cell receptor signaling pathway
    100451705 (IL4)
   04658 Th1 and Th2 cell differentiation
    100451705 (IL4)
   04659 Th17 cell differentiation
    100451705 (IL4)
   04657 IL-17 signaling pathway
    100451705 (IL4)
   04664 Fc epsilon RI signaling pathway
    100451705 (IL4)
   04672 Intestinal immune network for IgA production
    100451705 (IL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100451705 (IL4)
  09163 Immune disease
   05310 Asthma
    100451705 (IL4)
   05320 Autoimmune thyroid disease
    100451705 (IL4)
   05321 Inflammatory bowel disease
    100451705 (IL4)
   05330 Allograft rejection
    100451705 (IL4)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    100451705 (IL4)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100451705 (IL4)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100451705 (IL4)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100451705 (IL4)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Cytokines
   100451705 (IL4)
SSDB
Motif
Pfam: IL4 Mannosyl_trans3
Other DBs
NCBI-GeneID: 100451705
NCBI-ProteinID: XP_002815914
Ensembl: ENSPPYG00000015766
UniProt: H2PGI4 A0A663D5P8
LinkDB
Position
5
AA seq 153 aa
MGLTSQLLPPLFFLLACAGNFVHGHKCDIALQEIIKTLNSLTEQKTLCTELTVTDIFAAS
KNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGL
NSCPVKEANQSTLEDFLERLKTIMREKYSKCSS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgggtctcacctcccaactgcttccccctctgttcttcctgctagcatgtgccggcaac
tttgtccatggacacaagtgcgatatcgccttacaagagatcatcaaaactttgaacagc
ctcacagagcagaagactctgtgcaccgagttgaccgtaacggacatctttgctgcctcc
aagaacacaactgagaaggaaaccttctgcagggctgcgactgtgctccggcagttctac
agccaccatgagaaggacactcgctgtctgggtgcgactgcacagcagttccacagacac
aagcagctcatccgattcctgaaacggctcgacaggaacctctggggcctggcgggtttg
aattcctgtcctgtgaaggaagccaaccagagtacgttggaagacttcttggaaaggcta
aagacgatcatgagagaaaaatattcaaagtgttcgagctga

DBGET integrated database retrieval system