KEGG   Pongo abelii (Sumatran orangutan): 100451737
Entry
100451737         CDS       T01416                                 

Gene name
IGF2BP1
Definition
(RefSeq) insulin-like growth factor 2 mRNA-binding protein 1 isoform X1
  KO
K17391  insulin-like growth factor 2 mRNA-binding protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100451737 (IGF2BP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100451737 (IGF2BP1)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA binding proteins (RBPs)
    100451737 (IGF2BP1)
SSDB
Motif
Pfam: KH_1 KH_2 RRM_1 KH_4 MOEP19 KH_5 RRM_5 RRM_occluded DUF4041
Other DBs
NCBI-GeneID: 100451737
NCBI-ProteinID: XP_002834307
UniProt: A0A663DHA4 H2NVK1
LinkDB
Position
17
AA seq 577 aa
MNKLYIGNLNESVTPADLEKVFAEHKISYSGQFLVKSGYAFVDCPDEHWAMKAIETFSGK
VELQGKRLEIEHSVPKKQRSRKIQIRNIPPQLRWEVLDSLLAQYGTVENCEQVNTESETA
VVNVTYSNREQTRQAIMKLNGHQLENHALKVSYIPDEQIAQGPENGRRGGFGSRGQPRQG
SPVAAGAPAKQQQVDIPLRLLVPTQYVGAIIGKEGATIRNITKQTQSKIDVHRKENAGAA
EKAISVHSTPEGCSSACKMILEIMHKEAKDTKTADEVPLKILAHNNFVGRLIGKEGRNLK
KVEQDTETKITISSLQDLTLYNPERTITVKGAIENCCRAEQEIMKKVREAYENDVAAMSL
QSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAI
IGKKGQHIKQLSRFASASIKIAPPETPDSKVRMVIITGPPEAQFKAQGRIYGKLKEENFF
GPKEEVKLETHIRVPASAAGRVIGKGGKTVNELQNLTAAEVVVPRDQTPDENDQVIVKII
GHFYASQMAQRKIRDILAQVKQQHQKGQSNQAQARRK
NT seq 1734 nt   +upstreamnt  +downstreamnt
atgaacaagctttacatcggcaacctcaacgagagcgtgacccccgcggacttggagaaa
gtgtttgcggagcacaagatctcctacagcggccagttcttggtcaaatccggctacgcc
ttcgtggactgcccggacgagcactgggcgatgaaggccatcgaaactttctccgggaaa
gtagaattacaaggaaaacgcctagagattgaacattcggtgcccaaaaaacaaaggagc
cggaaaattcaaatccgaaatattccaccccagctccgatgggaagtactggacagcctg
ctggctcagtatggtacagtagagaactgtgagcaagtgaacaccgagagtgagacggca
gtggtgaatgtcacctattccaaccgggagcagaccaggcaagccatcatgaagctgaat
ggccaccagttggagaaccatgccctgaaggtctcctatatccctgatgagcagatagca
cagggacctgagaatgggcgccgagggggctttggctctcggggtcagccccgccagggc
tcacctgtggcagcgggggccccagccaagcagcagcaagtggacatcccccttcggctc
ctggtgcccacccagtatgtgggtgccatcattggcaaggagggggccaccatccgcaac
atcacaaaacagacccagtccaagatagacgtgcataggaaggagaacgcaggtgcagct
gaaaaagccatcagtgtgcactccacccctgagggctgctcctccgcttgtaagatgatc
ttggagattatgcataaagaggctaaggacaccaaaacggctgatgaggttcccctgaag
atcctggcccataataactttgtagggcgtctcattggcaaggaaggacggaacctgaag
aaggtagagcaagataccgagacaaaaatcaccatctcctcgttgcaagaccttaccctt
tacaaccctgagaggactatcactgtgaagggagccatcgagaattgttgcagggccgag
caggaaataatgaagaaggttcgggaggcctatgagaatgatgtggctgccatgagcctg
cagtctcacctgatccctggcctgaacctggctgctgtaggtcttttcccagcctcgtcc
agcgcagtcccgccgcctcccagcagcgttaccggggctgctccctatagctcctttatg
caggctcccgagcaggagatggtgcaggtgtttatccccgcccaggcagtgggtgccatc
atcggcaagaaggggcagcacatcaaacagctctcccggtttgccagcgcctccatcaag
attgcaccacccgaaacacctgactccaaagttcgtatggttatcatcactggaccgcca
gaggcccaattcaaggctcagggaagaatctatggcaaactcaaggaggagaacttcttt
ggtcccaaggaggaagtgaagctggagacccacatacgtgtgccagcatcagcagctggc
cgggtcattggcaaaggaggaaaaacggtgaacgagttgcagaatttgacggcagctgag
gtggtagtaccaagagaccagacccctgatgagaatgaccaggtcatcgtgaaaatcatc
ggacatttctatgccagtcagatggctcaacggaagatccgagacatcctggcccaggtt
aagcagcagcatcagaagggacagagtaaccaggcccaggcacggaggaagtga

DBGET integrated database retrieval system