KEGG   Pongo abelii (Sumatran orangutan): 100452123
Entry
100452123         CDS       T01416                                 

Gene name
CTBP2
Definition
(RefSeq) C-terminal-binding protein 2 isoform X1
  KO
K04496  C-terminal binding protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon05200  Pathways in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100452123 (CTBP2)
   04330 Notch signaling pathway
    100452123 (CTBP2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100452123 (CTBP2)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100452123 (CTBP2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100452123 (CTBP2)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Macropinocytosis
   Others
    100452123 (CTBP2)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2
Other DBs
NCBI-GeneID: 100452123
NCBI-ProteinID: XP_024109103
LinkDB
Position
10
AA seq 992 aa
MPVPSRHINIGRSQSWDAAGWYEGPWENAESLRPLGRRSSLTYGTAEGTWFEPNHRPQDA
ALPRAAEPYLYQEAVYNSVAARKGSTPDFTFYDSRQAVMSGRSPLLPRDYYSDPSGAARV
PKEPPLYRDPGVSRPVPSYGVLGSRTSWDPMQGRSPALQDAGHLYRDPGGKMIPQGQRTQ
SRAASPGRYGQEQPNTRYGAEGPAYPPSQVFSDISERPIDPAPARQVAPTCLVVDPSSAA
APEGSTGVAPGALNRGYGPARESIPSKMAYETYEADLSTFQGCGGRRTVPPEFLAFLRAE
GLAEATLAALLQQGFDSPAVLATLEDADIKSVAPNLGQARVLSRLANSCRTEMQLRRQDR
VGPLPRARSSSFSHRSELLHGDLASLGAVALQPQPAAPLQTASPRAGDPARRPSSAPSQH
LLETAATYSAPGVGAHAPHFSSNSGYSSPTPCALTARLSPTYPLQAGVALTNPGPSNPLH
PGPRTAYSTAYTVPMELLKRERNVAASPLPSPHGSPQVLRKPGAPLGPSTLPPASQSLHT
PHSPYQKVARRTGAPIIVSTMLAPEPSIRPQIMNGPLHPRPLVALLDGRDCTVEMPILKD
LATVAFCDAQSTQEIHEKVLNEAVGAMMYHTITLTREDLEKFKALRVIVRIGSGYDNVDI
KAAGELGIAVCNIPSAAVEETADSTICHILNLYRRNTWLYQALREGTRVQSVEQIREVAS
GAARIRGETLGLIGFGRTGQAVAVRAKAFGFSVIFYDPYLQDGIERSLGVQRVYTLQDLL
YQSDCVSLHCNLNEHNHHLINDFTIKQMRQGAFLVNAARGGLVDEKALAQALKEGRIRGA
ALDVHESEPFSFAQGPLKDAPNLICTPHTAWYSEQASLEMREAAATEIRRAITGRIPESL
RNCVNKEFFVTSAPWSVIDQQAIHPELNGATYRYPPGIVGVAPGGLPAAMEGIIPGGIPV
THNLPTVAHPSQAPSPNQPTKHGDNREHPNEQ
NT seq 2979 nt   +upstreamnt  +downstreamnt
atgccagttcccagcaggcatataaatattggtcgttctcagagctgggatgctgccggg
tggtacgagggcccctgggagaacgctgagtccctgcggcccctggggaggagaagctcc
ctgacgtatggcacagcagaggggacttggtttgagccaaaccaccgaccacaggacgct
gccctgcccagggccgccgagccctacctgtaccaggaggccgtttataactcagtggct
gcaagaaaggggtctactcctgacttcaccttctacgacagcagacaggcagtgatgtct
ggtcgcagccccctgctgccacgggattactacagtgacccgtctggagctgctagggta
cccaaagagcctcccctctatcgggacccaggagtcagccggccggtccccagctatgga
gtgcttggcagcagaacgtcatgggatccaatgcaaggccggtcacctgccctgcaggac
gccggtcacctgtaccgggatcctggaggtaaaatgatccctcaggggcagcggacacag
agcagggctgcatcccccgggcggtatggacaggagcagcccaacaccaggtatggggcg
gaggggcctgcctacccccccagccaggtcttcagtgacatcagcgaaagacctattgac
cctgcccctgccagacaggtggccccgacgtgcctggttgtggaccccagttcagctgct
gcccccgaaggcagcacaggggtggccccaggggccctgaatcgaggctatgggcctgcc
cgggaaagcatcccatccaagatggcttacgagacttacgaagctgacctgtccaccttc
cagggttgtggtggcaggaggactgtgccccctgagttcctggcctttctgcgggcggag
gggctggcagaggccacgctggcagccctactacagcagggctttgactctccggccgtc
ctggctaccctggaggacgcggatatcaagtctgtcgcacccaacctgggccaggcccgt
gttctgagccgcctggccaatagctgcaggactgagatgcagctgcggaggcaggaccgg
gtgggcccgctgccccgggcgcggtccagcagcttcagccaccgaagcgaactgctccat
ggtgacttggcttctctgggcgctgtggccctgcagccccagcctgcggctcctctgcag
acagcgtccccccgagctggagacccggctcgccgtccctccagcgcaccatctcagcac
ctcctggagacggcggccacctattctgcccctggcgtgggcgcccatgccccccacttc
tcctccaactccgggtacagctctcccaccccttgtgccctgacagcacgtctgagcccc
acgtaccccctgcaggcaggggtggccttgactaacccgggcccctcgaacccccttcac
ccaggccccagaacagcctactccacagcatacacggtgcccatggaactgctaaagagg
gagcgcaacgtggccgcctctccgctgcccagccctcacggcagcccccaggtcttgcgg
aagccaggtgcacccctggggccatccaccctgccgccggccagccagagcctccacacg
cctcactcaccgtaccagaaggtggcccggcgcacaggggcgcccatcatcgtgtccacc
atgcttgcaccagaaccaagtatccgcccccagatcatgaacggccccctgcacccccgc
cccctggtggcgctgctggacggccgcgactgcactgtggagatgcccatcctgaaggac
ctggccaccgtggccttctgtgacgcgcagtccacgcaggaaatccacgaaaaggttcta
aacgaagccgtgggtgccatgatgtaccacaccatcaccctcaccagggaggacctggag
aagttcaaggccctgagagtgattgtgcggataggcagcggctacgacaacgtggacatc
aaggctgccggtgagctcggaattgctgtgtgcaacattccatctgcagccgtggaagag
acggcggactctaccatctgccacatcctcaatctgtaccggaggaacacgtggctgtac
caggcactgcgggaaggcacgcgggttcagagcgtggagcagatccgcgaggtggcctcg
ggagcggcccgcatccgtggggagacgctgggcctcatcggctttggtcgcacggggcag
gcggttgcagttcgagccaaggcctttggattcagcgtcatattttatgacccctacttg
caggatgggatcgagcggtccctgggcgtgcagagggtctacaccctgcaggatttgctg
tatcagagcgactgcgtctccttgcactgcaatctcaacgaacataaccaccacctcatc
aatgactttaccataaagcagatgaggcagggagcattccttgtgaacgcagcccgtggt
ggcctggtggacgagaaagccttagcacaagccctcaaggagggcaggatacgaggggca
gccctcgacgtgcatgagtcagagcccttcagctttgctcagggtccattgaaagatgcc
ccgaatctcatctgcactcctcacactgcctggtacagtgagcaggcgtcactggagatg
agggaggcagctgccaccgagatccgccgagccatcacaggtcgcatcccagaaagctta
agaaattgtgtgaacaaggaattctttgtcacatcagcgccttggtcagtaatagaccag
caagcaattcatcctgagctcaatggtgccacatacagatatccgccaggcatcgtgggt
gtggctccaggaggacttcctgcagccatggaagggatcatccctggaggcatcccagtg
actcacaacctcccgacagtggcacatccttcccaagcgccctctcccaaccagcccaca
aaacacggggacaatcgagagcaccccaacgagcaatag

KEGG   Pongo abelii (Sumatran orangutan): 100461333
Entry
100461333         CDS       T01416                                 

Gene name
CTBP1
Definition
(RefSeq) C-terminal-binding protein 1 isoform X2
  KO
K04496  C-terminal binding protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04310  Wnt signaling pathway
pon04330  Notch signaling pathway
pon05200  Pathways in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100461333 (CTBP1)
   04330 Notch signaling pathway
    100461333 (CTBP1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100461333 (CTBP1)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100461333 (CTBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100461333 (CTBP1)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Macropinocytosis
   Others
    100461333 (CTBP1)
SSDB
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 XdhC_C Cellsynth_D
Other DBs
NCBI-GeneID: 100461333
NCBI-ProteinID: XP_002814548
Ensembl: ENSPPYG00000014524
UniProt: H2PCN7 A0A6D2X315
LinkDB
Position
4
AA seq 429 aa
MSGVRPPIMNGPLHPRPLVALLDGRDCTVEMPILKDVATVAFCDAQSTQEIHEKVLNEAV
GALMYHTITLTREDLEKFKALRIIVRIGSGFDNIDIKSAGDLGIAVCNVPAASVEETADS
TLCHILNLYRRATWLHQALREGTRVQSVEQIREVASGAARIRGETLGIIGLGRVGQAVAL
RAKAFGFNVLFYDPYLSDGVERALGLQRVSTLQDLLFHSDCVTLHCGLNEHNHHLINDFT
VKQMRQGAFLVNTARGGLVDEKALAQALKEGRIRGAALDVHESEPFSFSQGPLKDAPNLI
CTPHAAWYSEQASIEMREEAAREIRRAITGRIPDSLKNCVNKDHLTAATHWASMDPAVVH
PELNGAAYRYPPGVVGVAPTGIPAAVEGIVPSAMSLSHGLPPVAHPPHAPSPGQTVKPEA
DRDHASDQL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtcaggcgtccgacctccgatcatgaatgggcccctgcacccgcggcccctggtggcg
ttgctggatggccgggactgcacagtggagatgcccatcctgaaggacgtggccactgtg
gccttctgcgacgcgcagtccacgcaggagatccacgagaaggtcctgaatgaggctgtg
ggggccctgatgtaccacaccatcacactcaccagggaggacctggagaagttcaaagcc
ctccgcatcatcgtccggattggcagtggttttgacaacatcgacatcaagtcggccggg
gatttaggcatcgccgtctgcaacgtgcctgcagcgtctgtggaggagacggctgactcg
acgctgtgccacatcctgaacctgtaccggcgggccacctggctgcaccaggcgctgcgg
gagggtacacgagtccagagcgtcgagcagatccgcgaggtggcgtccggcgccgccagg
atccgcggggagaccttgggcatcatcggactcggtcgcgtggggcaggcagtggcgctg
cgggccaaggccttcggcttcaatgtgctcttctacgacccttacctgtcggacggtgtg
gagcgggcgctggggctgcagcgtgtcagcaccctgcaggacctgctcttccacagcgac
tgcgtgaccctgcactgcggcctcaacgagcacaaccaccacctcatcaacgacttcacc
gtcaagcagatgagacaaggggccttcctggtgaacacggcccggggcggcctggtggac
gagaaggcgctggcccaggccctgaaggagggccggatccgcggcgcggccctggacgtg
cacgagtcggaacccttcagctttagccagggccccctgaaggatgcacccaacctcatc
tgcaccccccatgctgcatggtacagcgagcaggcgtccatcgagatgcgagaggaggcg
gcacgggagatccgcagggccatcacaggccggatcccagacagcctgaagaactgtgtc
aacaaggaccatctgacggccgccacccactgggccagcatggaccccgccgtcgtgcac
cctgagctcaacggggctgcctataggtaccctccgggcgtggtgggcgtggcccccact
ggcatcccagctgctgtggaaggtatcgtccccagcgccatgtccctgtcccacggcctg
ccccctgtggcccacccaccccacgccccttctcctggccaaaccgtcaagcccgaggcg
gatagagaccacgccagtgaccagttgtag

DBGET integrated database retrieval system