KEGG   Pongo abelii (Sumatran orangutan): 100452211Help
Entry
100452211         CDS       T01416                                 

Gene name
ME1
Definition
(RefSeq) NADP-dependent malic enzyme
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00620  Pyruvate metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    100452211 (ME1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    100452211 (ME1)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     100452211 (ME1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic Trimer_CC
Motif
Other DBs
NCBI-GeneID: 100452211
NCBI-ProteinID: XP_024104406
Ensembl: ENSPPYG00000016806
LinkDB All DBs
Position
6
AA seq 572 aa AA seqDB search
MEPEAPRRRHTHQRGYLLTRNPHVNKDLAFTLEERQQLNIHGLLPPSFNSQEIQVLRVVK
NFEHLNSDFDRYLLLMDLQDRNEKLFYRVLTSDIEKFMPIVYTPTVGLACQQYSLVFRKP
RGLFISIHDRGHIASVLNAWPEDVIKAIVVTDGERILGLGDLGCNGMGIPVGKLALYTAC
GGMNPQECLPVILDVGTENEELLKDPLYIGLRQRRVRGSEYDDFLDEFMEAVSSKYGMNC
LIQFEDFANVNAFRLLNKYRNQYCTFNDDIQGTASVAVAGLLAALRITKNKLSDQTILFQ
GAGEAALGIAHLIVMALEKEGLPKEKAIKKIWLVDSKGLIVKGRASLTQEKEKFAHEHEE
MKNLEAIVQEIKPTALIGVAAIGGAFSEQILKDMAAFNERPIIFALSNPTSKAECSAEQC
YKITKGRAIFASGSPFDPVTLPNGQTLYPGQGNNSYVFPGVALGVVACGLRQITDKIFLT
TAEVIAQQVSDKHLEEGRLYPPLNTIRDVSLKIAEKIVKDAYQEKTATVYPEPQNKEAFV
RSQMYSTDYDQILPDCYSWPEEVQKIQTKVDQ
NT seq 1719 nt NT seq  +upstreamnt  +downstreamnt
atggagcccgaagccccccgtcgccgccacacccatcagcgcggctacctgctgacacgg
aaccctcacgtcaacaaggacttggcctttaccctggaagagagacagcaattgaacatt
catggattgttgccaccttccttcaacagtcaggagatccaggttcttagagtggtaaaa
aattttgagcatctgaactctgactttgacaggtatcttctcttaatggatctccaagat
agaaatgagaaactcttttatagagtgctaacatctgacattgagaaattcatgcctatt
gtttatactcccactgtgggtctggcttgccaacaatacagtttggtgtttcggaagcca
agaggtctctttattagtatccacgatcgagggcatattgcttcagttctcaacgcatgg
ccagaagatgtcatcaaggccattgtggtgactgatggagagcgtattcttggcttggga
gaccttggctgtaatggaatgggcatccctgtgggtaaattggctctatatacagcttgc
ggagggatgaatcctcaagaatgtctgcctgtcattctggatgtgggaaccgaaaatgag
gagttacttaaagatccactctacattggactacggcagagaagagtaagaggttctgaa
tatgatgattttttggacgaattcatggaggcagtttcttccaagtatggcatgaattgc
cttattcagtttgaagattttgccaatgtgaatgcatttcgtctcctgaacaagtatcga
aaccagtattgcacattcaatgatgatattcaaggaaccgcatctgttgcagttgccggt
ctccttgcagctcttcgaataaccaagaacaaactgtctgatcaaacaatactgttccaa
ggagctggggaggctgccctagggattgcacacctgattgtgatggccttggaaaaagaa
ggtttaccaaaagagaaagccatcaaaaagatatggctggttgattcaaaaggattaata
gttaagggacgtgcttccttaacacaagagaaagagaagtttgcccatgaacatgaagaa
atgaagaacctagaagccattgttcaagaaataaaaccaactgccctcataggagttgct
gcaattggtggtgcattctcagaacaaattctcaaagatatggctgccttcaatgaacgg
cctattatttttgctttgagtaatccaactagcaaagcagaatgttctgcagagcagtgc
tacaaaataaccaagggacgtgcaatttttgccagtggcagtccttttgatccagtcact
cttccaaatggacagaccttatatcctggccaaggcaataattcctatgtgttccctgga
gttgctcttggtgttgtggcgtgtggattgaggcagatcacagataagattttcctcact
actgctgaggttatagctcagcaagtgtcagataaacacttggaagagggtcggctttat
cctcctttgaataccattagagatgtttctctgaaaattgcagaaaagattgtgaaagat
gcataccaagaaaagacagccacagtttatcctgaaccacaaaacaaagaagcatttgtc
cgctcccagatgtatagtactgattatgaccagattctacctgattgttattcttggcct
gaagaggtccagaaaatacagaccaaagttgaccagtag

DBGET integrated database retrieval system