KEGG   Pongo abelii (Sumatran orangutan): 100452233
Entry
100452233         CDS       T01416                                 

Gene name
IRS2
Definition
(RefSeq) insulin receptor substrate 2
  KO
K07187  insulin receptor substrate 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04022  cGMP-PKG signaling pathway
pon04068  FoxO signaling pathway
pon04140  Autophagy - animal
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100452233 (IRS2)
   04022 cGMP-PKG signaling pathway
    100452233 (IRS2)
   04152 AMPK signaling pathway
    100452233 (IRS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100452233 (IRS2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100452233 (IRS2)
   04923 Regulation of lipolysis in adipocytes
    100452233 (IRS2)
   04920 Adipocytokine signaling pathway
    100452233 (IRS2)
   04935 Growth hormone synthesis, secretion and action
    100452233 (IRS2)
  09149 Aging
   04211 Longevity regulating pathway
    100452233 (IRS2)
   04213 Longevity regulating pathway - multiple species
    100452233 (IRS2)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100452233 (IRS2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100452233 (IRS2)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100452233 (IRS2)
   04932 Non-alcoholic fatty liver disease
    100452233 (IRS2)
   04931 Insulin resistance
    100452233 (IRS2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100452233 (IRS2)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Phosphotyrosine binding (PTB) domain-containing proteins
  IRS related family proteins
   100452233 (IRS2)
SSDB
Motif
Pfam: IRS PH PH_11
Other DBs
NCBI-GeneID: 100452233
NCBI-ProteinID: XP_024086711
LinkDB
Position
13
AA seq 1346 aa
MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEA
TAGGGSAPQPPRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDE
YFAVAAENEQEQEGWYRALTDLISEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGA
EDSYGLVAPATAAYREVWQVNLKPKGLGQSKNLTGVYRLCLSARTIGFVKLNCEQPSVTL
QLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVAQNIHETILEAMKALKELFEF
RPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAATPPAAKCSSCR
VRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQR
PSSGSASASGSPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGEFYG
YMTMDRPLSHCGRPYRRVSGDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLM
RATFSGSAGRLCPSCPASSPKVAYHPYPEDYGDIEIGSHRSSSSNLGADDGYMPMTPGAA
LAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAAVAVTPAGPAGPAPTSAASRTF
AASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVSPSDAVTTGTP
PDFFSAALHAGGEPLRGVPGCCYSSLPRSYKASYTCGGDSDQYVLMSSPVGRILEEERLE
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGSLGGGRPEGFLGQRGRAVRPTRLSLE
GLPSLPSMHEYPLPPEPKSPGEYINIDFGEPGAHLSPPAPPLLASAASSSSLLSASSPAS
SLGSGTPGTSSDSRQRSPLSDYMNLDFSSPKSPKPGAPSGHPVGSLDGLLSPEVSSLYPP
LPPRPSASPSSSLQPPPPPPPPGELYRLPPASAAATAQGPGAASSSSSDTGDNGDYTEMA
FGVAATPPQPIAAPPKPEAARVTSPTSGVKRLSLMEQVSGVEAFLQASQPPDPHRGAKVI
RADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGVGVGPGG
SDEPPISPRQLQPALPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNY
IAIDVREEPGLPPQPQPQPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSSGGGCGGPGPG
ALPPANTYASIDFLSHHLKEATIVKE
NT seq 4041 nt   +upstreamnt  +downstreamnt
atggcgagcccgccgcggcacgggccgcccgggccggcgagcggagacggccccaacctc
aacaacaacaacaacaacaacaaccacagcgtgcgcaagtgcggctacctgcgcaagcag
aagcacggccacaagcgcttcttcgtgctgcgcgggcccggcgcgggcggcgacgaggcg
acggcgggcggggggtcggctccgcagccgccgcggctcgagtactacgagagcgagaaa
aagtggcggagcaaggcaggcgcgccgaaacgggtgatcgcgctcgactgctgcttgaac
atcaacaagcgcgccgacgccaagcacaagtacctgatcgccctctacaccaaggacgaa
tacttcgccgtggccgccgagaacgagcaggagcaggagggctggtaccgcgcgctcacc
gacctgatcagcgagggccgcgcggccgccggagacgcgccccccgccgccgcacccgcc
gcgtcctgcagcgcctccctgcccggcgccctgggcggctctgccggcgccgccggggcc
gaggacagctacgggctggtggcgcccgccacggccgcctaccgtgaggtgtggcaggtg
aacctgaagcccaagggtctgggccagagcaagaacctgacgggcgtgtaccgtctgtgc
ctgtcggcgcgcaccatcggcttcgtgaagctcaactgcgagcagccgtcggtgacgctg
cagctcatgaacatccgccgctgcggccactcggacagctttttcttcatcgaggtgggc
cgctcggccgtcacaggccccggcgagctgtggatgcaggcggacgactcggtggtggcg
cagaacatccatgagaccatcctggaggccatgaaggcgctcaaggagctcttcgagttc
cggccgcgcagcaagagccagtcgtcggggtcgtcggccacgcaccccatcagcgtcccc
ggcgcgcgccgccaccaccacctggtcaacctgccccccagccagacgggcctggtgcgc
cgctcgcgcaccgacagcctggccgccaccccgccggcggccaagtgcagctcgtgccgg
gtgcgtaccgccagcgagggcgatggcggcgcggcggcgggggcggcggccgcgggcgcc
aggccggtgtcggtggccgggagccccctgagccccgggccggtgcgcgcgcccctgagc
cgctcgcacaccctgagcggcggctgcggcggccgcgggagcaaggtggcgctgctgccg
gcagggggcgcgttgcagcacagccgctccatgtccatgcccgtggcgcactcgccgccc
gccgccaccagccccggttccctgtcgtccagcagcggccacggctcgggctcctacccg
ccgccgcccggcccgcacccgcccctgccgcatccgctgcaccacggccccggccagcgg
ccctccagcggcagcgcctccgcctcgggctcccccagcgaccccggcttcatgtccctg
gacgagtacggttccagcccaggcgacctgcgcgccttctgcagtcaccgaagcaacacg
cccgagtccatcgcggaaacgcccccggcccgagacggcggcggcggtgagttctacggg
tacatgaccatggacaggcccctgagccactgtggccgcccctaccgccgggtctcgggg
gacgcggcccaggacctggaccgagggctgcgcaagaggacctactccctgaccacgccg
gcccggcagcggccggtgccccagccctcctctgcctcgctggatgagtacaccctgatg
cgggccaccttctcgggcagcgcgggccgcctctgcccgtcctgccccgcgtcgtctccc
aaggtggcttaccacccctacccggaggactacggagacatcgagatcggctcccacagg
agctccagcagcaacctgggcgcagacgacggctacatgcccatgacgcccggcgcggcc
ctcgcgggcagtgggagcggcagctgcaggagcgacgactacatgcccatgagccccgcc
agcgtgtccgcccccaagcagatcttgcagcccagggccgccgctgccgccgccgccgtc
gccgtgacccctgcggggcctgcgggaccagcgcccacctctgcggcgagcaggacattc
gcggcgagtgggggcggctacaaggccagctcgcccgccgagagctcccccgaggacagt
gggtacatgcgcatgtggtgcggctccaagctgtccatggagcatgcagatggcaagctg
ctgcccaacggggactacctcaacgtgtcccccagcgacgcggtcaccacgggcaccccg
cccgacttcttctccgcagccctgcacgccggcggggagccgctcaggggcgttcctggc
tgctgctacagctccttgcctcgctcctacaaggcctcctacacctgcggcggggacagc
gaccagtacgtgctcatgagctcccccgtggggcgcatcctggaggaggagcggctggag
cctcaggccacgccagggcccagccaggcggccagcgccttcggggccggccccacgcag
ccccctcaccccgtagtgccttcgcccgtgcggcccagcggcagcctaggcggcggccgc
ccggagggcttcttgggccagcgcggccgggcggtgaggcccacgcgcctgtccctggag
gggctgcccagcctgcccagcatgcacgagtacccactgccaccggagcccaagagcccc
ggcgagtacatcaacatcgacttcggcgagcccggggcccacctgtcgccgcccgcgcct
cccctgctggcgtcggcggcctcgtcctcctcgctcttgtccgccagcagcccggcctcg
tcgctgggctcaggcaccccgggcaccagcagcgacagccggcagcgctctccgctctcc
gactacatgaacctcgacttcagctcccccaagtctcctaagccgggcgccccgagcggc
caccccgtgggctccttggacggcctcctgtcccccgaggtctcctccctgtatccgccg
ctgcccccgcgtccgtccgcgtccccgtcgtcgtccctgcagccgccgccaccgccgccg
cccccgggggagctgtaccgcctgccccccgcctcggccgccgccaccgcccagggcccg
ggcgccgcctcatcgtcgtcctcggacaccggggacaatggtgactacaccgagatggct
tttggtgtggccgccaccccgccgcaaccaatcgcggcccccccgaagccagaagctgcc
cgcgtgaccagcccgacgtcgggcgtgaagaggctgagcctcatggagcaggtgtcaggg
gtcgaggccttcctgcaggccagccagcccccggacccccaccgcggcgccaaggtcatc
cgcgcagacccgcaggggggccgccgccgccacagttccgagaccttctcctccaccacg
acggtcacccccgtgtccccgtccttcgcccacaaccccaagcgccacaactcggcctcc
gtggaaaatgtctctctcaggaaaagcagcgagggcggcgtgggtgtcggccctggaggg
agcgacgagccgcccatctccccccgacagttgcagccggcgctcccggcgccccctttg
gcaccgcagggccggccgtggaccccgggtcagcccgggggcttggtcggttgtcctggg
agcggtggatcgccaatgcgcagagagacctctgctggcttccagaatggtctcaactac
atcgccatcgacgtaagggaggagcccgggctgccaccccagccgcagccgcagccgccg
ccgccgcttcctcagccgggagacaagagctcctggggtcggacccgaagcctcgggggt
ctcatcagcgctgtgggcgtcggcagcagcggcggcgggtgtggggggccgggtcccggt
gccctgccccctgccaacacctacgccagcattgacttcttgtcccaccacttgaaggag
gccaccattgtgaaagagtga

DBGET integrated database retrieval system