KEGG   Pongo abelii (Sumatran orangutan): 100452289
Entry
100452289         CDS       T01416                                 

Gene name
CBLB
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL-B isoform X1
  KO
K22517  E3 ubiquitin-protein ligase CBL-B [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04144  Endocytosis
pon04625  C-type lectin receptor signaling pathway
pon04660  T cell receptor signaling pathway
pon04910  Insulin signaling pathway
pon05162  Measles
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100452289 (CBLB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100452289 (CBLB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100452289 (CBLB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100452289 (CBLB)
   04660 T cell receptor signaling pathway
    100452289 (CBLB)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100452289 (CBLB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    100452289 (CBLB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100452289 (CBLB)
   04121 Ubiquitin system [BR:pon04121]
    100452289 (CBLB)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100452289 (CBLB)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100452289 (CBLB)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100452289 (CBLB)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 UBA zf-RING_4
Other DBs
NCBI-GeneID: 100452289
NCBI-ProteinID: XP_002813377
Ensembl: ENSPPYG00000013580
UniProt: H2P9U4 A0A6D2XXN4
LinkDB
Position
3
AA seq 982 aa
MANSTNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISVFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDEGSRCCSIIDPFGMPMLDLDDDDDREESLMMNRLANVRKCTDRQNSPVTS
PGSSPLAQRRKPQPDPLQIPHLSLPPVPPRLDLIQKGIVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHIHHVESVPSRDPPMPLEAWCPRDVFG
TNQLVGCRLLGEGSPKPGITASSNVNGRHSRVGSDPVLMRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPPPVTTLLPSIKCTGPLANSLSEKTRDPVEEDDDEYKIPSSHPVSLN
SQPSHCHNVKPPVRSCDNGHCMLNGTHGPSSEKKSNIPDLGIYLKGDVFDSASDPVPLPP
ARPPTRDNPKHGSSLNRTPSDYDLLIPPLGEDAFDALPPSLPPPPPPARHSLIEHSKPPG
SSSRPSSGQDLFLLPSDPFVDLASGQVPLPPARRLPGENVKTNRTSQDYDQLPSCSDGSQ
APARPPKPRPRRTAPEIHHRKPHGPEAALENVDAKIAKLMGEGYAFEEVKRALEIAQNNV
EVARSILREFAFPPPVSPRLNL
NT seq 2949 nt   +upstreamnt  +downstreamnt
atggcaaactcaacgaatggcagaaaccctggtggtcgaggaggaaatccccgaaaaggt
cgaattttgggtattattgatgctattcaggatgcagttggaccccctaagcaagctgcc
gcagatcgcaggaccgtggagaagacttggaagctcatggacaaagtggtaagactgtgc
caaaatcccaaacttcagttgaaaaatagcccaccatatatacttgatattttgcctgat
acatatcagcatttacgacttatattgagtaaatatgatgacaaccagaaacttgcccaa
ctcagtgagaatgagtactttaaaatctacattgatagccttatgaaaaagtcaaaacgg
gcaataagactctttaaagaaggcaaggagagaatgtatgaagaacagtcacaggacaga
cgaaatctcacaaaactgtcccttatcttcagtcacatgctggcagaaatcaaagcaatc
tttcctaatggtcaattccagggagataactttcgtatcacaaaagcagatgctgctgaa
ttctggagaaagttttttggagacaaaactatcgtaccatggaaagtattcagacagtgc
cttcatgaggtccaccaaattagctctggtctggaagcaatggctctaaaatcaacaatt
gatttaacttgcaatgattacatttcagtttttgaatttgatatttttaccaggctgttt
cagccttggggctctattttgcggaattggaatttcttagctgtgacacatccaggttac
atggcatttctcacgtatgatgaagttaaagcacgactacagaaatatagcaccaaaccc
ggaagctatattttccggttaagttgcactcgattgggacagtgggccattggctatgtg
actggggatgggaatatcttacagaccatacctcataacaagcccttatttcaagccctg
attgatggcagcagggaaggattttatctttatcctgatgggaggagttataatcctgat
ttaactggattatgtgaacctacacctcatgaccatataaaagttacacaggaacaatat
gaattatattgtgaaatgggctccacttttcagctctgtaagatttgtgcagagaatgac
aaagatgtcaagattgagccttgtgggcatttgatgtgcacctcttgccttacggcatgg
caggagtcggatggtcagggctgccctttctgtcgttgtgaaataaaaggaactgagccc
ataatcgtggacccctttgatccaagagatgaaggctccaggtgttgcagcatcattgac
ccctttggcatgccgatgctcgacttggacgacgatgatgatcgagaggagtccttgatg
atgaatcggttggcgaatgtccgaaagtgcactgacaggcagaactcaccagtcacatca
cctggatcctctccccttgcccagagaagaaagccacagcctgacccactccagatccca
catctaagcctgccaccagtgcctcctcgtctggatctaattcagaaaggcatagttaga
tctccctgtggcagcccaacaggttcaccaaagtcatctccttgcatggtgagaaaacaa
gataaaccactcccagcaccacctcctcccttaagagatcctcctccaccgccacctgaa
agacctcccccaatcccaccagacaatagactgagtagacacatccatcatgtggaaagc
gtgccttccagagacccgccaatgcctcttgaagcatggtgccctcgggatgtgtttggg
actaatcagcttgtgggatgtcgactcctaggggagggctctccaaaacctggaatcaca
gcgagttcaaatgtcaatggaaggcacagcagagtgggctcggacccagtgcttatgcgg
aaacacagacgccatgatttgcctttagaaggcgctaaggtcttttccaatggtcacctt
ggaagtgaagaatatgatgttcctccccgactttctcctcctcctccagttactaccctc
ctccctagcataaagtgtactggtccgttagcaaattctctttcagagaaaacaagagac
ccagtagaggaagatgatgatgaatacaagattccttcatcccaccctgtttccctgaat
tcacagccatctcattgtcataatgtaaaacctcctgttcggtcttgtgataatggtcac
tgtatgctgaatggaacacatggtccatcttcagagaagaaatcaaacatccctgactta
ggcatatatttaaagggagatgtttttgattcagcctctgatccagtgccattaccacct
gccaggcctccaactcgggacaatccaaagcatggttcttcactcaacaggacgccctct
gattatgatcttctcatccctccattaggtgaagatgcttttgatgccctccctccatct
ctcccacctcccccacctcctgcaaggcatagtctcattgaacattcaaaacctcctggc
tccagtagccggccatcctcaggacaggatctttttcttcttccttcagatccctttgtt
gatctagcaagtggccaagttcctttgcctcccgctagaaggttaccaggtgaaaatgtc
aaaactaacagaacatcacaggactatgatcagcttccttcatgttcagatggttcacag
gcaccagccagaccccctaaaccacgaccccgcaggactgcaccagaaattcaccacaga
aaaccccacgggcctgaggcagcattggaaaatgtcgatgcaaaaattgcaaaactcatg
ggagagggttatgcctttgaagaggtgaagagagccttagagatagcccagaataatgtc
gaagttgcccggagcatcctccgagaatttgccttccctccaccagtatccccacgtcta
aatctatag

KEGG   Pongo abelii (Sumatran orangutan): 100462634
Entry
100462634         CDS       T01416                                 

Gene name
CBL
Definition
(RefSeq) E3 ubiquitin-protein ligase CBL
  KO
K04707  E3 ubiquitin-protein ligase CBL [EC:2.3.2.27]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04012  ErbB signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon04144  Endocytosis
pon04910  Insulin signaling pathway
pon05100  Bacterial invasion of epithelial cells
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05220  Chronic myeloid leukemia
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100462634 (CBL)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100462634 (CBL)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100462634 (CBL)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100462634 (CBL)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462634 (CBL)
   05205 Proteoglycans in cancer
    100462634 (CBL)
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100462634 (CBL)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100462634 (CBL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100462634 (CBL)
   04121 Ubiquitin system [BR:pon04121]
    100462634 (CBL)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.27  RING-type E3 ubiquitin transferase
     100462634 (CBL)
Membrane trafficking [BR:pon04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    100462634 (CBL)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   CBL proteins
    100462634 (CBL)
SSDB
Motif
Pfam: Cbl_N Cbl_N3 Cbl_N2 Prok-RING_4 zf-C3HC4_3 zf-C3HC4 zf-RING_2 UBA zf-C3HC4_2 zf-RING_UBOX zf-RING_5 zf-rbx1 zf-C3HC4_4 zf-RING_4
Other DBs
NCBI-GeneID: 100462634
NCBI-ProteinID: XP_002822650
Ensembl: ENSPPYG00000003962
LinkDB
Position
11
AA seq 905 aa
MAGNVKKSSGAGGGSGSGGSGSGGLIGLMKDAFQPHHHHHHLSPHPPGTVDKKMVEKCWK
LMDKVVRLCQNPKLALKNSPPYILDLLPDTYQHLRTILSRYEGKMETLGENEYFRVFMEN
LMKKTKQTISLFKEGKERMYEENSQPRRNLTKLSLIFSHMLAELKGIFPSGLFQGDTFRI
TKADAAEFWRKAFGEKTIVPWKSFRQALHEVHPISSGLEAMALKSTIDLTCNDYISVFEF
DIFTRLFQPWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLG
QWAIGYVTADGNILQTIPHNKPLFQALIDGFREGFYLFPDGRNQNPDLTGLCEPTPQDHI
KVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQESEGQGCPFCRC
EIKGTEPIVVDPFDPRGSGSLLRQGAEGAPSPNYDDDDDERADDTLFMMKELAGAKVERP
PSPFSMAPQASLPPVPPRLDLLPQRVCVPSSASALGTASKAASGSLHKDKPLPVPPTLRD
LPPPPPPDRPYSVGAESRPQRRPLPCTPGDCPSRDKLPPVPSSRLGDSWLPRPIPKVPVS
APSSSDAWTGRELTNRHSLPFSLPSQMEPRPDVPRLGSTFSLDTSMSVNSSPLVGPECDH
PKIKPSSSANAIYSLAARPLPVPKLPPGEQCEGEEDTEYMTPSSRPLRPLDTSQSSRACD
CDQQIDSCTYEAMYNIQSQAPSVTESSTFGEGNLAAAHANTGPEESENEDDGYDVPKPPV
PAVLARRTLSDISNASSSFGWLSLDGDPTTNVTEGSQVPERPPKPFPRRINSERKAGSCQ
QGSGPAASAATASPQLSSEIENLMSQGYSYQDIQKALVIAQNNIEMAKNILREFVSISSP
AHVAT
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggccggcaacgtgaagaagagctctggggccgggggcggcagcggctccgggggctcg
ggttcgggtggcctgattgggctcatgaaggacgccttccagccgcaccaccaccaccac
cacctcagcccccacccgccggggacggtggacaagaagatggtggagaagtgctggaag
ctcatggacaaggtggtgcggttgtgtcagaacccaaagctggcgctaaagaatagccca
ccttatatcttagacctgctaccagatacctaccagcatctccgtactatcttgtcaaga
tatgaggggaagatggagacacttggagaaaatgagtattttagggtgtttatggagaat
ttgatgaagaaaactaagcaaaccataagcctcttcaaggagggaaaagaaagaatgtat
gaggagaattctcagcctaggcgaaacctaaccaaactgtccctcatcttcagccacatg
ctggcagaactaaaaggaatctttccaagtggactctttcagggagacacatttaggatt
actaaagcagatgctgcggaattttggagaaaagcttttggggaaaagacaatagtccct
tggaagagctttcgacaggctttacatgaagtgcatcccatcagttctgggctggaggcc
atggctctgaaatccactattgatctgacctgcaatgattatatttcggtttttgaattt
gacatcttcacccgactctttcagccctggtcctctttgctcaggaattggaacagcctc
gctgtaactcatcctggctacatggcttttttgacgtatgacgaagtgaaagctcggctc
cagaaattcattcacaaacctggcagttatatcttccggctgagctgtactcgtctgggt
cagtgggctattgggtatgttactgctgatgggaacattctccagacaatccctcacaat
aaacctctcttccaagcactgattgatggcttcagggaaggcttctatttgtttcctgat
ggacgaaatcagaatcctgatctgactggcttatgtgaaccaactccccaagaccatatc
aaagtgacccaggaacaatatgaattatactgtgagatgggctccacattccaactgtgt
aaaatatgtgctgaaaatgataaggatgtaaagattgagccctgtggacacctcatgtgc
acatcctgtcttacatcctggcaggaatcagaaggtcagggctgtcctttctgccgatgt
gaaattaaaggtactgaacccatcgtggtagatccgtttgatcctagagggagtggcagc
ctattgaggcaaggagcagagggagctccctccccaaattatgatgatgatgatgatgaa
cgagctgatgatactctcttcatgatgaaggaattggctggtgccaaggtggaacggccg
ccttctccattctccatggccccacaagcttcccttcccccagtgccaccacgacttgac
cttctgccgcagcgagtatgtgttccctcaagtgcttctgctcttggaactgcttctaag
gctgcttctggctcccttcataaagacaaaccattgccagtacctcccacacttcgagat
cttccaccaccaccacctccagaccggccatattccgttggagcagaatcccgacctcaa
agacgccccttgccttgtacaccaggcgattgtccatccagagacaaactgccccctgtc
ccctctagccgccttggagattcatggctgccccggccaatccccaaagtaccagtatct
gccccaagttccagtgatgcctggacaggaagagaattaaccaaccggcactcacttcca
ttttcattgccctcacaaatggagcccagaccagatgtgcctaggctcggaagcacattc
agtctggatacctccatgagtgtgaatagcagcccattagtaggtccagagtgtgaccac
cccaaaatcaaaccttcctcatctgccaatgccatttattctctggctgccagacctctt
cctgtgccaaaactgccacctggggagcaatgtgagggtgaagaggacacagagtacatg
actccctcctccaggcctctacggcctttggatacatcccagagttcacgagcatgtgat
tgcgaccagcagattgatagctgtacgtatgaagcaatgtataatattcagtcccaggcg
ccatctgtcaccgagagcagcacctttggtgaagggaatttggctgcagcccatgccaac
actggtcccgaggagtcagaaaatgaggatgatgggtatgatgtcccaaagccacctgtg
ccggccgtgctggcccgccgaactctctcagatatctctaatgccagctcctcctttggc
tggttgtctctggatggtgatcccacaacaaatgtcactgaaggttcccaagttcccgag
aggcctcctaaaccattccctcggagaatcaactctgaacggaaagctggcagctgtcag
caaggtagtggtcctgccgcctctgctgccaccgcctcgcctcagctctccagtgagatc
gagaacctcatgagtcaggggtactcctaccaggacatccagaaagctttggtcattgcc
cagaacaacatcgagatggccaaaaacatcctccgggaatttgtttccatttcttctcct
gcccatgtagctacctag

DBGET integrated database retrieval system