KEGG   Pongo abelii (Sumatran orangutan): 100452403
Entry
100452403         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 3-phosphoinositide-dependent protein kinase 1
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon03320  PPAR signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04931  Insulin resistance
pon04960  Aldosterone-regulated sodium reabsorption
pon05145  Toxoplasmosis
pon05205  Proteoglycans in cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05223  Non-small cell lung cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100452403
   04071 Sphingolipid signaling pathway
    100452403
   04151 PI3K-Akt signaling pathway
    100452403
   04152 AMPK signaling pathway
    100452403
   04150 mTOR signaling pathway
    100452403
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100452403
  09143 Cell growth and death
   04210 Apoptosis
    100452403
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100452403
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    100452403
   04664 Fc epsilon RI signaling pathway
    100452403
  09152 Endocrine system
   04910 Insulin signaling pathway
    100452403
   03320 PPAR signaling pathway
    100452403
   04919 Thyroid hormone signaling pathway
    100452403
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100452403
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100452403
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100452403
   05231 Choline metabolism in cancer
    100452403
  09162 Cancer: specific types
   05215 Prostate cancer
    100452403
   05213 Endometrial cancer
    100452403
   05223 Non-small cell lung cancer
    100452403
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100452403
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100452403
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100452403
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100452403
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100452403
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100452403
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   100452403
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    100452403
SSDB
Motif
Pfam: Pkinase PH_3 PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal APH Kdo
Other DBs
NCBI-GeneID: 100452403
NCBI-ProteinID: XP_024089437
Ensembl: ENSPPYG00000007004
LinkDB
Position
16
AA seq 556 aa
MARTTSQLYDAVPIQSSVVLCSCPSPSMVRTQTESSTPPGIPGGSRQSPAMDGTAAEPRP
GAGSLQHAQPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILEKRHIIK
ENKVPYVTRERDVMSRLDHPXFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKIGSFDET
CTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPESKQARAN
SFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKIIKLEYD
FPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQTPPKLTA
YLPAMSEDDEDCYGNYDNLLSQFGCMQVSSSSSSHSLSASDAGLPQRSGSNIEQYIHDLD
SNSFELDLQFSEDEKRLLLEKQAGGNPWHQFVENNLILKMGPVDKRKGLFARRRQLLLTE
GPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQ
EVWRQRYQSHPDAAVQ
NT seq 1671 nt   +upstreamnt  +downstreamnt
atggccaggaccaccagccagctgtatgacgccgtgcccatccagtccagcgtggtgtta
tgttcctgcccatccccatcaatggtgaggacccagactgagtccagcacgccccctggc
attcctggtggcagcaggcagagccctgccatggatggcactgcagccgagcctcggcct
ggtgctggctccctgcagcatgcccagcctccgccacagcctcggaagaagcggcctgag
gacttcaagtttgggaaaattcttggggaaggctctttttccacggttgtcctggctcga
gaactggcaacctccagagaatacgcgattaaaattctggagaagcgacatatcataaaa
gagaacaaggtcccgtatgtaaccagagagcgggatgtcatgtcgcgcctggatcaccct
ntctttgttaagctttacttcacatttcaggacgacgagaagctgtatttcggccttagt
tatgccaaaaatggagaactacttaaatatattcgcaaaatcggttcattcgatgagacc
tgtacccgattttacacggctgagattgtgtctgctttagagtacttgcacggcaagggc
atcattcacagggaccttaaaccggaaaacattttgttaaatgaagatatgcacatccag
atcacagattttggaacagcaaaagtcttatccccagagagcaaacaagccagggccaac
tcattcgtgggaacagcgcagtacgtttctccagagctgctcacggagaagtccgcctgt
aagagttcagacctttgggctcttggatgcataatataccagcttgtggcaggactccca
ccattccgagctggaaacgagtatcttatatttcagaagatcattaaattggaatatgac
tttccagaaaaattcttccctaaggcaagagacctcgtggagaaacttttggttttagac
gccacaaagcggttaggctgtgaggaaatggaagggtacggacctcttaaagcacacccg
ttcttcgagtccgtcacgtgggagaacctgcaccagcagacgcctccgaagctcaccgct
tacctgccggccatgtcggaagacgacgaggactgctatggcaattatgacaatctcctg
agccagtttggctgcatgcaggtgtcctcgtcctcctcctcacactccctgtcagcctcg
gacgcgggcctgccccagaggtcaggcagcaacatagagcagtacattcacgatctggac
tcgaactcctttgaactggacttacagttttccgaagacgagaagaggttgttgttggag
aagcaggctggcggaaacccttggcaccagtttgtagaaaataatttaatactaaagatg
ggcccggtggataagcggaagggtttatttgcacgacgacgacagctgttgctcacagaa
ggaccacatttatattatgtggatcctgtcaacaaagtcctgaaaggtgaaattccttgg
tcacaagaacttcgaccagaggccaagaattttaaaactttctttgtccacacacctaac
aggacgtattatctgatggaccccagcgggaacgcacacaagtggtgcaggaagatccag
gaggtttggaggcagcgataccagagccacccggacgccgctgtgcagtga

KEGG   Pongo abelii (Sumatran orangutan): 112129400
Entry
112129400         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: putative 3-phosphoinositide-dependent protein kinase 2
  KO
K06276  3-phosphoinositide dependent protein kinase-1 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon03320  PPAR signaling pathway
pon04068  FoxO signaling pathway
pon04071  Sphingolipid signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04210  Apoptosis
pon04510  Focal adhesion
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04722  Neurotrophin signaling pathway
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04931  Insulin resistance
pon04960  Aldosterone-regulated sodium reabsorption
pon05145  Toxoplasmosis
pon05205  Proteoglycans in cancer
pon05213  Endometrial cancer
pon05215  Prostate cancer
pon05223  Non-small cell lung cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    112129400
   04071 Sphingolipid signaling pathway
    112129400
   04151 PI3K-Akt signaling pathway
    112129400
   04152 AMPK signaling pathway
    112129400
   04150 mTOR signaling pathway
    112129400
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    112129400
  09143 Cell growth and death
   04210 Apoptosis
    112129400
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    112129400
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    112129400
   04664 Fc epsilon RI signaling pathway
    112129400
  09152 Endocrine system
   04910 Insulin signaling pathway
    112129400
   03320 PPAR signaling pathway
    112129400
   04919 Thyroid hormone signaling pathway
    112129400
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    112129400
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    112129400
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    112129400
   05231 Choline metabolism in cancer
    112129400
  09162 Cancer: specific types
   05215 Prostate cancer
    112129400
   05213 Endometrial cancer
    112129400
   05223 Non-small cell lung cancer
    112129400
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    112129400
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    112129400
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    112129400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    112129400
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    112129400
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     112129400
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  PDK1 family
   112129400
Membrane trafficking [BR:pon04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Acrosomal exocytosis proteins
    112129400
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo APH YukC RIO1
Other DBs
NCBI-GeneID: 112129400
NCBI-ProteinID: XP_024089438
LinkDB
Position
16
AA seq 429 aa
MCRITEGKVSLTVPQYGAVPIQSRVVLCSCPSPSMVRTQTESSTAPGIPGGSRQGPAMDG
TASEPRPGTGSLEHXPPPQPRKKRPEDFKFGKILGEGSFSTVVLARELATSREYAIKILE
KRHIIKENKVPYVTRERDVMSRLDHPFFVKLYFTFQDDEKLYFGLSYAKNGELLKYIRKI
GSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNEDMHIQITDFGTAKVLSPES
KQARANSFVGTAQYVSPELLTEKSACKSSDLWALGCIIYQLVAGLPPFRAGNEYLIFQKI
IKLEYDFPEKFFPKARDLVEKLLVLDATKRLGCEEMEGYGPLKAHPFFESVTWENLHQQT
PPKLTAYLPAMSEDDEDCYGNVSXPGWRARRVALGPPCTGLHARAPDPRVICSRKGRVSV
PLRQACWWL
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgtgcaggatcaccgaggggaaagtgagcttgacagtcccccagtatggtgccgtaccc
atccagtccagagtggtgttatgttcctgcccatccccatcaatggtgaggacccagact
gagtccagcacagcccctggcattcctggtggcagcaggcagggccccgccatggacggc
accgcatccgagcctcggcctggcaccggctccctggagcacnnaccgccgccgcagcct
cggaagaagcggcctgaggacttcaagtttgggaaaattcttggggaaggctctttttcc
acggttgtcctggctcgagaactggcaacctccagagaatacgcgattaaaattctggag
aagcgacatatcataaaagagaacaaggtcccgtatgtaaccagagagcgggatgtcatg
tcgcgcctggatcaccccttctttgttaagctttacttcacatttcaggacgacgagaag
ctgtatttcggccttagttatgccaaaaatggagaactacttaaatatattcgcaaaatc
ggttcattcgatgagacctgtacccgattttacacggctgagattgtgtctgctttagag
tacttgcacggcaagggcatcattcacagggaccttaaaccggaaaacattttgttaaat
gaagatatgcacatccagatcacagattttggaacagcaaaagtcttatccccagagagc
aaacaagccagggccaactcattcgtgggaacagcgcagtacgtttctccagagctgctc
acggagaagtccgcctgtaagagttcagacctttgggctcttggatgcataatataccag
cttgtggcaggactcccaccattccgagctggaaacgagtatcttatatttcagaagatc
attaaattggaatatgactttccagaaaaattcttccctaaggcaagagacctcgtggag
aaacttttggttttagacgccacaaagcggttaggctgtgaggaaatggaagggtacgga
cctcttaaagcacacccgttcttcgagtccgtcacgtgggagaacctgcaccagcagacg
cctccgaagctcaccgcttacctcccagccatgtcggaagacgacgaggactgctatggc
aatgtaagcntgccgggatggcgggcgaggcgggtggcactgggtcctccgtgcactggg
cttcatgcccgtgcgccagacccacgtgtgatttgtagccgaaaggggagggtgtctgtg
ccactgcggcaggcctgctggtggttgtag

DBGET integrated database retrieval system