KEGG   Pongo abelii (Sumatran orangutan): 100452449
Entry
100452449         CDS       T01416                                 

Gene name
WAS
Definition
(RefSeq) LOW QUALITY PROTEIN: wiskott-Aldrich syndrome protein
  KO
K05747  Wiskott-Aldrich syndrome protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04062  Chemokine signaling pathway
pon04520  Adherens junction
pon04530  Tight junction
pon04666  Fc gamma R-mediated phagocytosis
pon05135  Yersinia infection
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100452449 (WAS)
   04530 Tight junction
    100452449 (WAS)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100452449 (WAS)
   04062 Chemokine signaling pathway
    100452449 (WAS)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    100452449 (WAS)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100452449 (WAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100452449 (WAS)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100452449 (WAS)
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100452449 (WAS)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    100452449 (WAS)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    WASP / WAVE
     100452449 (WAS)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 EVH1 / WASP  homology  (WH) domain-containing proteins
  WH1 domain-containing proteins
   100452449 (WAS)
SSDB
Motif
Pfam: WH1 PBD WH2
Other DBs
NCBI-GeneID: 100452449
NCBI-ProteinID: XP_024096506
LinkDB
Position
X
AA seq 498 aa
MSGGPMGGRPGGRGAPAVQQNIPSTLLQDHENQRLFEMLGRKCLTLATAVVQLYLALPPG
AEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGRLLWEQELYSQLVYSTPTPFFHTFAGD
DCQAGLNFADEDEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPTPANEERRGGLPPLPPH
PGGDQGGPPVGPLSLGLATVDIQNPDITSSRYRGLPAPGPSPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPIVGGNKGRSGPLPPVPLGVAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPLPPPXPGAGGPPMPPPPPPPPPPPSSGNGPAPPPLPPALV
PAGGLAPGGGRGALLDQIRQGIQLNKTPGAPESSPPQSSEGLVGALMHVMQKRSRAIHSS
DEGEDQAGDEDEDDEWDD
NT seq 1497 nt   +upstreamnt  +downstreamnt
atgagtgggggcccaatgggaggaaggcccgggggccgaggagcaccagcggttcagcag
aacataccctccacccttctccaggaccacgagaaccagcgactcttcgagatgcttgga
cgaaaatgcttgacactggccactgcagttgttcagctgtacctggcgctgccccctgga
gctgagcactggaccaaggagcattgtggggctgtgtgcttcgtgaaggataacccccag
aagtcctacttcatccgcctttacggccttcaggctggtcggctgctctgggaacaggag
ctgtactcacagcttgtctactccacccccactcccttcttccacacctttgctggagat
gactgccaagcggggctgaactttgcagacgaggatgaggctcaggccttccgggccctg
gtgcaagagaagatacaaaaaaggaatcagaggcaaagtggagacagacgccagctaccc
ccaccaccaacaccagccaatgaagagagaagaggagggctcccacccctgcccccgcac
ccaggtggagaccaaggaggccctccagtcggtccgctctccctggggctggcgacagtg
gacatccagaaccctgacatcacgagttcacgataccgtgggctcccagcacctggacct
agcccagctgataagaaacgctcagggaagaagaagatcagcaaagctgatattggtgca
cccagtggattcaagcatgtcagccacgtggggtgggacccccagaatggatttgacgtg
aacaacctcgacccagatctgcggagtctgttctccagggcaggaatcagcgaggcccag
ctcaccgacgccgagacctctaaacttatctacgacttcattgaggaccagggtgggctg
gaggctgtgcggcaggagatgaggcgccaggagccacttccgccgcccccaccgccatct
cgaggagggaaccagcccccccggcctcctattgtggggggtaacaagggtcgttctggt
ccactgccccctgtacctttgggggttgccccacccccaccaacaccccggggaccccca
cccccaggccgagggggccctccaccaccaccccctccagctactggacgttctggacca
ctgccccctccancccctggagctggtgggccacccatgccacccccaccgccccccccg
ccaccgccgcccagctccgggaatggaccagcccctcccccactccctcctgctctggtg
cctgctgggggcctggcccctggtgggggtcggggagcgcttttggatcaaattcggcag
ggaattcagctgaacaagacccctggggccccagagagctcaccacctcagagctcagag
ggactggtgggggccctgatgcacgtgatgcagaagagaagcagagccatccactcctcc
gacgaaggggaggaccaggctggcgatgaagatgaagatgatgaatgggatgactga

DBGET integrated database retrieval system