KEGG   Pongo abelii (Sumatran orangutan): 100452954
Entry
100452954         CDS       T01416                                 

Gene name
MYB
Definition
(RefSeq) transcriptional activator Myb isoform X1
  KO
K09420  transcriptional activator Myb
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100452954 (MYB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100452954 (MYB)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    100452954 (MYB)
SSDB
Motif
Pfam: Cmyb_C Myb_DNA-binding Myb_DNA-bind_6 LMSTEN Myb_DNA-bind_7 SANT_DAMP1_like Spore_III_AB
Other DBs
NCBI-GeneID: 100452954
NCBI-ProteinID: XP_024104740
LinkDB
Position
6
AA seq 761 aa
MARRPRHSIYSSDEDDEDFEMCDHDYDGLLPKSGKRHLGKTRWTREEDEKLKKLVEQNGT
DDWKVIANYLPNRTDVQCQHRWQKVLNPELIKGPWTKEEDQRVIELVQKYGPKRWSVIAK
HLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRIIYQAHKRLGNRWAEIAKLLPGRTDNA
IKNHWNSTMRRKVEQEGYLQESSKASQPAVATSFQKNSHLMGFAQAPPTAQLPATGQPTV
NNDYSYYHISEAQNVSSHVPYPVALHVNIVNVPQPAAAAIQRHYNDEDPEKEKRIKELEL
LLMSTENELKGQQALPTQNHTCSYPGWHSTTIADHTRPHGDSAPVSCLGEHHSTPSLPAD
PGSLPEESASPARCMIVHQGTILDNVKNLLEFAETLQFIDSDSSSWCDLSSFEFFEEADF
SPSQHHTGKALQLQQREGNGTKPAGEPSPRVNKRMLSDSSLDPPKVLPPARHSTIPLVIL
RKKRGQASPLATGDSSSFIFADVSSSTPKRSPVKSLPFSPSQFLNTSSNHENSDLEMPSL
TSTPLIGHKLTVTTPFHRDQTVKTQKENAVFRTPAIKRSILESSPRTPTPFKHALAAQEI
KYGPLKMLPQTPSHLVEDLQDVIKQESDESGIVAEFQENGPPLLKKIKQEVESPTDKSGN
FFCSHHWEGDSLNTQLFTQTSPVADAPNILTSSVLMAPASEDEDNVLKAFTVPKNRSLAS
PLQPCSSTWEPASCGKMEEQMTASSQARKYVNAFSARTLVM
NT seq 2286 nt   +upstreamnt  +downstreamnt
atggcccgaagaccccggcacagcatatatagcagtgacgaggatgatgaggactttgag
atgtgtgaccatgactatgatgggctgcttcccaagtctggaaagcgtcacttggggaaa
acaaggtggacccgggaagaggatgaaaaactgaagaagctggtggaacagaatggaaca
gatgactggaaagttattgccaattatctcccgaatcgaacagatgtgcagtgccaacat
cgatggcagaaagtactaaaccctgagctcatcaagggtccttggaccaaagaagaagat
cagagagtgatagagcttgtacagaaatacggtccgaaacgttggtctgttattgccaag
cacttaaaggggagaattggaaaacaatgtagggagaggtggcataaccacttgaatcca
gaagttaagaaaacctcctggacagaagaggaagacagaattatttaccaggcacacaag
agactggggaacagatgggcagaaatcgcaaagctactgcctggacgaactgataatgct
atcaagaaccactggaattctacaatgcgtcggaaggtcgaacaggaaggttatctgcag
gagtcttcaaaagccagccagccagcagtggccacaagcttccagaagaacagtcatttg
atgggttttgctcaggctccacctacagctcaactccctgcaactggccagcccactgtt
aacaacgactattcctattaccacatttctgaagcacaaaatgtctccagtcatgttcca
taccctgtagcgttacatgtaaatatagtcaatgtccctcagccagctgccgccgccatt
cagagacactataatgatgaagaccctgagaaggaaaagcgaataaaggaattagaattg
ctcctaatgtcaaccgagaatgagctaaaaggacagcaggcgctaccaacacagaaccac
acatgcagctaccccgggtggcacagcaccaccattgctgaccacaccagacctcatgga
gacagtgcacctgtttcctgtttgggagaacaccactccactccatctctgccagcggat
cctggctccctacctgaagaaagcgcctcgccagcaaggtgcatgatcgtccaccagggc
accattctggataatgttaagaacctcttagaatttgcagaaacactccaatttatagat
tctgattcttcatcatggtgtgatctcagcagttttgaattctttgaagaagcagatttt
tcacctagccaacatcacacaggcaaagccctacagcttcagcaaagagagggcaatggg
actaaacctgcaggagaacctagcccaagggtgaacaaacgtatgttgagtgacagttca
cttgacccacccaaggtcttacctcctgcaaggcacagcacaattccactggtcatcctt
cgaaaaaaacggggccaggccagccccttagccactggagactctagctccttcatattt
gctgacgtcagcagttcaactcccaagcgttcccctgtcaaaagcctacccttctctccc
tcgcagttcttaaacacttccagtaaccatgaaaactcagacttggaaatgccttcttta
acttccacccccctcattggtcacaaattgactgttacaacaccatttcatagagaccag
actgtgaaaactcaaaaggaaaatgctgtttttagaaccccagctatcaaaaggtcaatc
ttggaaagctctccaagaactcctacaccattcaaacatgcacttgcagctcaagaaatt
aaatatggtcccctgaagatgctacctcagacaccctctcatctagtagaagatctgcag
gatgtgatcaaacaggaatctgatgaatctggaattgttgctgagtttcaagaaaatgga
ccacccttactgaagaaaatcaaacaagaggtggaatctccaactgataaatcaggaaac
ttcttctgctcacaccactgggaaggggacagtctgaatacccaactgttcacgcagacc
tcgcctgtggcagatgcaccgaatattcttacaagctccgttttaatggcaccagcatca
gaagatgaagacaatgttctcaaagcatttacagtacctaaaaacaggtccctggcgagc
cccttgcagccttgtagcagtacctgggaacctgcatcctgtggaaagatggaggagcag
atgacagcttccagtcaagctcgtaaatacgtgaatgcattctcagcccggacgctggtc
atgtga

DBGET integrated database retrieval system