KEGG   Pongo abelii (Sumatran orangutan): 100453027
Entry
100453027         CDS       T01416                                 

Gene name
LAT
Definition
(RefSeq) linker for activation of T-cells family member 1 isoform X2
  KO
K07362  linker for activation of T cells
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04064  NF-kappa B signaling pathway
pon04650  Natural killer cell mediated cytotoxicity
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04664  Fc epsilon RI signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05135  Yersinia infection
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100453027 (LAT)
   04015 Rap1 signaling pathway
    100453027 (LAT)
   04064 NF-kappa B signaling pathway
    100453027 (LAT)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100453027 (LAT)
   04660 T cell receptor signaling pathway
    100453027 (LAT)
   04658 Th1 and Th2 cell differentiation
    100453027 (LAT)
   04659 Th17 cell differentiation
    100453027 (LAT)
   04664 Fc epsilon RI signaling pathway
    100453027 (LAT)
   04666 Fc gamma R-mediated phagocytosis
    100453027 (LAT)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100453027 (LAT)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100453027 (LAT)
SSDB
Motif
Pfam: LAT
Other DBs
NCBI-GeneID: 100453027
NCBI-ProteinID: XP_003778637
Ensembl: ENSPPYG00000007220
LinkDB
Position
16
AA seq 233 aa
MEEAILVPCVLGLLLLPILAVLMALCVHCHRLPGSYDSTSSDSLYPRGIQFKRPHTVAPW
PPAYPLVTSYPPLSPPDLLPIPRSPQPLGGSHRTPSSRRDSDGVNSVASYENEEPACEDA
DEDEDDYHNPGYLVVLPDSTPAASTAAPSAPALSTPGIRDSAFSMESIDDYVNVPESGES
AEASLDGSREYVNVSQELHPGAAKTEPAALSSQEAEEVEEEGAPDYENLQELN
NT seq 702 nt   +upstreamnt  +downstreamnt
atggaggaggccatcctggtcccctgtgtgctggggctcctgctgctgcccatcctggcc
gtgttgatggcactgtgtgtgcactgccacagactgccaggctcctatgacagcacatcc
tcagatagtttgtatccaaggggcatccagttcaaacggcctcacacggtcgccccctgg
ccacctgcctacccgcttgtcacctcctacccacccctgagcccgccagacctgctcccc
atcccaagatccccgcagcccctcgggggctcccaccggacgccatcttcccggcgggat
tctgatggtgtcaacagtgtggcgagctacgagaacgaggaaccagcctgtgaggacgcg
gatgaggatgaggatgactatcacaacccgggctacctggtggtgcttcccgacagcacc
ccggctgctagcactgctgccccatcagctcctgccctcagcacccctggcatccgagac
agtgccttctccatggagtccattgatgattacgtgaacgttccggagagcggggagagc
gcagaagcgtctctggatggcagccgggagtatgtgaatgtgtcccaggaactgcatcct
ggagcggctaagactgagcctgccgccctgagttcccaggaggcagaggaagtggaggaa
gagggggctccagattacgagaatctgcaggagctgaactga

DBGET integrated database retrieval system