KEGG   Pongo abelii (Sumatran orangutan): 100453552Help
Entry
100453552         CDS       T01416                                 

Gene name
TGM6
Definition
(RefSeq) protein-glutamine gamma-glutamyltransferase 6 isoform X1
  KO
K05624  transglutaminase 6 [EC:2.3.2.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100453552 (TGM6)
Enzymes [BR:pon01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100453552 (TGM6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100453552
NCBI-ProteinID: XP_002830163
Ensembl: ENSPPYG00000010842
UniProt: H2P1E9
LinkDB All DBs
Position
20
AA seq 706 aa AA seqDB search
MAGIRVTKVDWQRSRNGTAHHTQEYPCPELVVRRGQSFSLTLELSRALDCEETLIFTVET
GPQASEALHTKAVFQTSELEQGEGWTAAKEAQMENTLTVSLASPPNAVIGRYLLSIRLSS
HRKHSNRRLGEFVLLFNPWCAEDDVFLASEEERQEYVLNDSGIIFRGVEKHIRAQGWNYG
QFEEDILNICLSILDQSPGHQNNPATDVSCRHDPIYVTRVISAMVNSNNDRGVVQGQWQG
KYSGGTSPLHWRGSVAILQKWLKGRYKPVKYGQCWVFAGVMCTVLRCLGIATRVVSNFNS
AHDTDQNLSVDKYVDSFGRTLEDLTEDSMWNFHVWNESWFARQDLGPSYNGWQVLDATPQ
EESEGVFRCGPASVTAIREGDVHLAHDGPFVFAEVNADYITWLWHEDESRERVYSNTKKI
GRCISTKAVGSDSRVDITDLYKYPEGSRKERQVYSKAVKRLFSMEASGRRIRIRRAGGRC
LWRDNLLEPATKPSIAGKFKVLEPPMLGHDLRLALCLANLTSRAQRVRVNLSGATILYTR
KPVAEILHESHALRLGPQEEKRIPITISYSKYKEDLTEDKKILLAAMCLVTKGEKLLVEK
DITLEDFITIKVLGPAVVGVAVTVEVTVVNPLLERVKDCALMVEGSGLLQEQLSIDVPTL
EPQERASVQFDITPSKSGPRQLQVDLVSPHFPDIKGFVIVHVATAK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggcagggatcagagtcaccaaggtggactggcagcggtcaaggaatggcactgcccac
cacacccaggagtacccctgccctgagctggtggttcgcaggggccagtcgttcagcctt
acgctggagctgagcagagccctggactgtgaggagaccctcatcttcacggtggagaca
ggaccccaggcttctgaggccctccacaccaaagctgtgttccagacatcggagctggag
cagggtgagggctggacagcagcaaaggaggctcagatggagaacactctgactgtcagc
ctcgccagccctcccaatgctgtcattggccgctacctgctgagcatcaggctttcctct
caccgcaaacacagcaaccggaggctgggcgagtttgttctccttttcaacccatggtgt
gcagaggacgatgtgtttctggcctcagaggaggagagacaggagtacgtgctcaacgac
agcggcatcatcttccgaggcgtggagaagcatatacgagcccagggctggaactacggg
cagtttgaggaggacatcttgaacatctgcctctccatcctggatcaaagccccggtcac
caaaacaacccagccacagacgtgtcctgccgccacgaccccatctatgtcaccagggtc
atcagtgccatggtgaacagcaacaatgaccgaggtgtggtgcaaggacagtggcagggc
aagtacagcggcggcaccagcccgctgcactggcgaggcagcgtggccattctgcagaag
tggctcaagggcaggtacaagccagtcaagtacggccagtgctgggtcttcgcgggagtc
atgtgcacagtcctcaggtgcttggggatagccacacgggtcgtgtccaacttcaactca
gcccacgacacagaccagaacctgagtgtggacaaatacgtggactccttcgggcggacc
ctggaggacctgacagaagacagcatgtggaatttccatgtctggaatgagagctggttt
gcccggcaggacctaggcccctcttacaatggctggcaggttctggatgccaccccccag
gaggagagtgaaggtgtgttccggtgcggcccagcctcagtcactgccatccgcgagggt
gatgtgcacctggcccacgatggccccttcgtgtttgcggaggtcaacgccgactacatc
acctggctgtggcatgaggatgagagccgggagcgtgtatactcaaacacgaagaagatt
gggagatgcatcagcaccaaggcagtgggcagtgactcccgcgtggacatcaccgacctc
tacaagtatccggaagggtcccggaaagagaggcaggtgtacagcaaggcggtgaagagg
ctgttcagcatggaagcctctggaaggagaatccggatccgcagggctggggggcgctgt
ctctggcgtgacaacctcctggagcccgccaccaagcccagcatcgctggcaagttcaag
gtgctagagcctcccatgctgggccacgacctgagactggccctgtgcttggccaacctc
acctcccgggcccagcgggtgagggtcaacctgagcggtgccaccatcctctacacccgc
aagccagtggcagagatcctgcatgaatcccacgccttgaggctggggccacaagaagag
aagagaatcccaattacaatatcttactctaagtataaagaagacctgacagaagacaag
aagatcctgttggctgccatgtgccttgtcaccaaaggagagaagcttctggtggagaag
gacattactctagaggacttcatcaccatcaaggttctgggcccagccgtggtgggagtg
gcagttacagtggaagtgacagtagtcaaccccctcttagagagagtgaaggactgtgcg
ctgatggtggagggcagcggccttctccaggaacagctcagcatcgatgtgcccaccctg
gagcctcaggagagggcctcagtccagtttgacatcaccccctccaagagtggcccaagg
cagctgcaggtggaccttgtaagccctcacttcccggacatcaagggctttgtgatcgtc
catgtggccactgccaagtga

DBGET integrated database retrieval system