KEGG   Pongo abelii (Sumatran orangutan): 100453682
Entry
100453682         CDS       T01416                                 

Gene name
CDKN1A
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1
  KO
K06625  cyclin-dependent kinase inhibitor 1A
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon01524  Platinum drug resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04110  Cell cycle
pon04115  p53 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04630  JAK-STAT signaling pathway
pon04921  Oxytocin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05203  Viral carcinogenesis
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05211  Renal cell carcinoma
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100453682 (CDKN1A)
   04630 JAK-STAT signaling pathway
    100453682 (CDKN1A)
   04066 HIF-1 signaling pathway
    100453682 (CDKN1A)
   04068 FoxO signaling pathway
    100453682 (CDKN1A)
   04151 PI3K-Akt signaling pathway
    100453682 (CDKN1A)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100453682 (CDKN1A)
   04115 p53 signaling pathway
    100453682 (CDKN1A)
   04218 Cellular senescence
    100453682 (CDKN1A)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    100453682 (CDKN1A)
   04928 Parathyroid hormone synthesis, secretion and action
    100453682 (CDKN1A)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453682 (CDKN1A)
   05202 Transcriptional misregulation in cancer
    100453682 (CDKN1A)
   05206 MicroRNAs in cancer
    100453682 (CDKN1A)
   05205 Proteoglycans in cancer
    100453682 (CDKN1A)
   05203 Viral carcinogenesis
    100453682 (CDKN1A)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100453682 (CDKN1A)
   05212 Pancreatic cancer
    100453682 (CDKN1A)
   05225 Hepatocellular carcinoma
    100453682 (CDKN1A)
   05226 Gastric cancer
    100453682 (CDKN1A)
   05214 Glioma
    100453682 (CDKN1A)
   05216 Thyroid cancer
    100453682 (CDKN1A)
   05220 Chronic myeloid leukemia
    100453682 (CDKN1A)
   05217 Basal cell carcinoma
    100453682 (CDKN1A)
   05218 Melanoma
    100453682 (CDKN1A)
   05211 Renal cell carcinoma
    100453682 (CDKN1A)
   05219 Bladder cancer
    100453682 (CDKN1A)
   05215 Prostate cancer
    100453682 (CDKN1A)
   05213 Endometrial cancer
    100453682 (CDKN1A)
   05224 Breast cancer
    100453682 (CDKN1A)
   05222 Small cell lung cancer
    100453682 (CDKN1A)
   05223 Non-small cell lung cancer
    100453682 (CDKN1A)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100453682 (CDKN1A)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100453682 (CDKN1A)
   05161 Hepatitis B
    100453682 (CDKN1A)
   05160 Hepatitis C
    100453682 (CDKN1A)
   05163 Human cytomegalovirus infection
    100453682 (CDKN1A)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453682 (CDKN1A)
   05169 Epstein-Barr virus infection
    100453682 (CDKN1A)
   05165 Human papillomavirus infection
    100453682 (CDKN1A)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100453682 (CDKN1A)
   01522 Endocrine resistance
    100453682 (CDKN1A)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 100453682
NCBI-ProteinID: XP_002816862
Ensembl: ENSPPYG00000016549
UniProt: A0A6D2X6A2 A0A2J8Y3L2
LinkDB
Position
6
AA seq 164 aa
MSEPAGDVRPNPCGSKACRRLFGPVDSEQLSRDCDALMAGCIQEARERWNFDFVTETPLE
GDFVWERVRGLGLPKLYLPTGPWRGRDELGGGRRPGTSPALLQGTAEEDHVDLSLSCTLV
PRSGEQAEGSPGGPGDSQGRKRRQTSMTDFYHSKRRLIFSKRKP
NT seq 495 nt   +upstreamnt  +downstreamnt
atgtcagaaccagctggggatgtccgtccgaacccatgcggcagcaaggcctgccgccgc
ctcttcggcccagtggacagcgagcagctgagccgcgactgtgatgcgctaatggcgggc
tgcatccaggaggctcgtgagcgatggaacttcgactttgtcaccgagacaccattggag
ggtgacttcgtctgggagcgtgtgcggggccttggcctgcccaagctctaccttcccacg
gggccctggcggggcagggatgagttgggaggaggcaggcggcctggcacctcacctgct
ctgctgcaggggacagcagaggaagaccatgtggacctgtcgctgtcttgtacccttgtg
cctcgctcaggggagcaggctgaagggtccccaggtggacctggagactctcagggtcga
aaacggcggcagaccagcatgacagatttctaccactccaaacgccggctgatcttctcc
aagaggaagccctaa

DBGET integrated database retrieval system