KEGG   Pongo abelii (Sumatran orangutan): 100453941
Entry
100453941         CDS       T01416                                 

Gene name
IL6
Definition
(RefSeq) interleukin-6 isoform X2
  KO
K05405  interleukin 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01523  Antifolate resistance
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04657  IL-17 signaling pathway
pon04659  Th17 cell differentiation
pon04668  TNF signaling pathway
pon04672  Intestinal immune network for IgA production
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05010  Alzheimer disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05132  Salmonella infection
pon05133  Pertussis
pon05134  Legionellosis
pon05135  Yersinia infection
pon05142  Chagas disease
pon05143  African trypanosomiasis
pon05144  Malaria
pon05146  Amoebiasis
pon05152  Tuberculosis
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05321  Inflammatory bowel disease
pon05323  Rheumatoid arthritis
pon05332  Graft-versus-host disease
pon05410  Hypertrophic cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100453941 (IL6)
   04668 TNF signaling pathway
    100453941 (IL6)
   04066 HIF-1 signaling pathway
    100453941 (IL6)
   04068 FoxO signaling pathway
    100453941 (IL6)
   04151 PI3K-Akt signaling pathway
    100453941 (IL6)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100453941 (IL6)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100453941 (IL6)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    100453941 (IL6)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100453941 (IL6)
   04620 Toll-like receptor signaling pathway
    100453941 (IL6)
   04621 NOD-like receptor signaling pathway
    100453941 (IL6)
   04623 Cytosolic DNA-sensing pathway
    100453941 (IL6)
   04625 C-type lectin receptor signaling pathway
    100453941 (IL6)
   04659 Th17 cell differentiation
    100453941 (IL6)
   04657 IL-17 signaling pathway
    100453941 (IL6)
   04672 Intestinal immune network for IgA production
    100453941 (IL6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100453941 (IL6)
   05202 Transcriptional misregulation in cancer
    100453941 (IL6)
  09163 Immune disease
   05323 Rheumatoid arthritis
    100453941 (IL6)
   05321 Inflammatory bowel disease
    100453941 (IL6)
   05332 Graft-versus-host disease
    100453941 (IL6)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453941 (IL6)
   05020 Prion disease
    100453941 (IL6)
   05022 Pathways of neurodegeneration - multiple diseases
    100453941 (IL6)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100453941 (IL6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100453941 (IL6)
   04931 Insulin resistance
    100453941 (IL6)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100453941 (IL6)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100453941 (IL6)
   05135 Yersinia infection
    100453941 (IL6)
   05133 Pertussis
    100453941 (IL6)
   05134 Legionellosis
    100453941 (IL6)
   05152 Tuberculosis
    100453941 (IL6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100453941 (IL6)
   05161 Hepatitis B
    100453941 (IL6)
   05171 Coronavirus disease - COVID-19
    100453941 (IL6)
   05164 Influenza A
    100453941 (IL6)
   05162 Measles
    100453941 (IL6)
   05168 Herpes simplex virus 1 infection
    100453941 (IL6)
   05163 Human cytomegalovirus infection
    100453941 (IL6)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100453941 (IL6)
   05169 Epstein-Barr virus infection
    100453941 (IL6)
  09174 Infectious disease: parasitic
   05146 Amoebiasis
    100453941 (IL6)
   05144 Malaria
    100453941 (IL6)
   05142 Chagas disease
    100453941 (IL6)
   05143 African trypanosomiasis
    100453941 (IL6)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100453941 (IL6)
   01523 Antifolate resistance
    100453941 (IL6)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100453941 (IL6)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100453941 (IL6)
SSDB
Motif
Pfam: IL6 IL11 IL23 Phage_int_SAM_1 GCSF
Other DBs
NCBI-GeneID: 100453941
NCBI-ProteinID: XP_002818205
Ensembl: ENSPPYG00000017740
UniProt: A0A6D2YB13 A0A2J8VE68
LinkDB
Position
7
AA seq 212 aa
MNSVSTSAFGPVAFSLGLLLVLPAALPAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYI
LDGISALRKETCNKSNMCESSKEALAENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLL
EFEVYLEYLQNRFESSEEQARAVQMSTKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQ
AQNQWLQDMTTHLILRSFKEFLQSSLRALRQM
NT seq 639 nt   +upstreamnt  +downstreamnt
atgaactccgtctccacaagcgccttcggtccagttgccttctccctggggctgctcctg
gtgttgcctgctgccttacctgccccagtaccaccaggagaagattccaaagatgtagcc
gccccacacagacagccactcacctcttcagaacgaattgacaaacaaattcggtacatc
ctcgacggcatctcagccctgagaaaggagacttgtaacaagagtaacatgtgtgaaagc
agcaaagaggcactggcagaaaacaacctgaaccttccaaagatggctgaaaaagatgga
tgcttccaatctggattcaatgaggagacttgcctggtgaaaatcatcactggtcttttg
gagtttgaggtatacctagagtacctccagaacaggtttgagagcagtgaggaacaagcc
agagctgtgcagatgagtacaaaagtcctgatccagttcctgcagaaaaaggcaaagaat
ctagatgcaataactacccctgacccaaccacgaatgccagcctgctgacgaagctgcag
gcacagaaccagtggctgcaggacatgacaactcatctcattctgcgcagctttaaggag
ttcctgcagtccagcctgagggctcttcggcaaatgtag

DBGET integrated database retrieval system