KEGG   Pongo abelii (Sumatran orangutan): 100453978
Entry
100453978         CDS       T01416                                 

Gene name
INS
Definition
(RefSeq) insulin isoform X1
  KO
K04526  insulin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04022  cGMP-PKG signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04114  Oocyte meiosis
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04810  Regulation of actin cytoskeleton
pon04910  Insulin signaling pathway
pon04911  Insulin secretion
pon04913  Ovarian steroidogenesis
pon04914  Progesterone-mediated oocyte maturation
pon04917  Prolactin signaling pathway
pon04923  Regulation of lipolysis in adipocytes
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04932  Non-alcoholic fatty liver disease
pon04940  Type I diabetes mellitus
pon04950  Maturity onset diabetes of the young
pon04960  Aldosterone-regulated sodium reabsorption
pon05010  Alzheimer disease
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100453978 (INS)
   04014 Ras signaling pathway
    100453978 (INS)
   04015 Rap1 signaling pathway
    100453978 (INS)
   04066 HIF-1 signaling pathway
    100453978 (INS)
   04068 FoxO signaling pathway
    100453978 (INS)
   04072 Phospholipase D signaling pathway
    100453978 (INS)
   04022 cGMP-PKG signaling pathway
    100453978 (INS)
   04151 PI3K-Akt signaling pathway
    100453978 (INS)
   04152 AMPK signaling pathway
    100453978 (INS)
   04150 mTOR signaling pathway
    100453978 (INS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100453978 (INS)
  09143 Cell growth and death
   04114 Oocyte meiosis
    100453978 (INS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453978 (INS)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    100453978 (INS)
   04910 Insulin signaling pathway
    100453978 (INS)
   04923 Regulation of lipolysis in adipocytes
    100453978 (INS)
   04913 Ovarian steroidogenesis
    100453978 (INS)
   04914 Progesterone-mediated oocyte maturation
    100453978 (INS)
   04917 Prolactin signaling pathway
    100453978 (INS)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100453978 (INS)
  09149 Aging
   04211 Longevity regulating pathway
    100453978 (INS)
   04213 Longevity regulating pathway - multiple species
    100453978 (INS)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100453978 (INS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100453978 (INS)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100453978 (INS)
   04940 Type I diabetes mellitus
    100453978 (INS)
   04950 Maturity onset diabetes of the young
    100453978 (INS)
   04932 Non-alcoholic fatty liver disease
    100453978 (INS)
   04931 Insulin resistance
    100453978 (INS)
SSDB
Motif
Pfam: Insulin
Other DBs
NCBI-GeneID: 100453978
NCBI-ProteinID: XP_024110664
LinkDB
Position
11
AA seq 203 aa
MALWMRLLPLLALLALWGPDPAQAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED
LQASALSPSSSTSTWPEGLDATARAPPALVATANIGQAGRSSSRQFRQRALGTSDSPVLF
IHCPGAAGTAQGLGYRGRRVTAELVWEEVDSSPQPQGSESLPAQPPAQPAPEPEPQQARV
AREPSPEVSCCGLWPRRPQRSQN
NT seq 612 nt   +upstreamnt  +downstreamnt
atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac
ccggcccaggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac
ctagtgtgcggggaacgaggcttcttctacacacccaagacccgccgggaggcagaggac
ctgcaggcctcagccttgtccccctcctcctccacatcaacctggccagagggtctggac
gccacagccagggcaccccctgctttggtggcgactgctaatattggccaggccggcaga
tcatcgtccaggcagtttcggcagagagccttgggcaccagtgactccccagtcctcttt
atccactgtccaggagctgcggggactgcgcagggactagggtacaggggccgaagagtc
accgccgagcttgtgtgggaggaggtggattccagcccccagccccagggctctgaatcg
ctgccagctcagccccctgcccagcctgccccagagcctgagccccagcaggccagagtg
gccagagagcccagtcctgaggtgagctgctgcggcctgtggcccaggcgaccccagcgc
tcccagaactga

DBGET integrated database retrieval system