KEGG   Pongo abelii (Sumatran orangutan): 100453984
Entry
100453984         CDS       T01416                                 

Gene name
ITGA5
Definition
(RefSeq) integrin alpha-5
  KO
K06484  integrin alpha 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04145  Phagosome
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04512  ECM-receptor interaction
pon04640  Hematopoietic cell lineage
pon04810  Regulation of actin cytoskeleton
pon05100  Bacterial invasion of epithelial cells
pon05133  Pertussis
pon05135  Yersinia infection
pon05165  Human papillomavirus infection
pon05168  Herpes simplex virus 1 infection
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05410  Hypertrophic cardiomyopathy
pon05412  Arrhythmogenic right ventricular cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100453984 (ITGA5)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    100453984 (ITGA5)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    100453984 (ITGA5)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100453984 (ITGA5)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100453984 (ITGA5)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100453984 (ITGA5)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100453984 (ITGA5)
   05205 Proteoglycans in cancer
    100453984 (ITGA5)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100453984 (ITGA5)
   05412 Arrhythmogenic right ventricular cardiomyopathy
    100453984 (ITGA5)
   05414 Dilated cardiomyopathy
    100453984 (ITGA5)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100453984 (ITGA5)
   05133 Pertussis
    100453984 (ITGA5)
   05100 Bacterial invasion of epithelial cells
    100453984 (ITGA5)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    100453984 (ITGA5)
   05165 Human papillomavirus infection
    100453984 (ITGA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100453984 (ITGA5)
   04515 Cell adhesion molecules [BR:pon04515]
    100453984 (ITGA5)
   04090 CD molecules [BR:pon04090]
    100453984 (ITGA5)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100453984 (ITGA5)
Cell adhesion molecules [BR:pon04515]
 Integrins
  Integrin alpha subunits
   100453984 (ITGA5)
CD molecules [BR:pon04090]
 Proteins
  100453984 (ITGA5)
SSDB
Motif
Pfam: Integrin_alpha2 FG-GAP VCBS Integrin_alpha
Other DBs
NCBI-GeneID: 100453984
NCBI-ProteinID: XP_024112486
Ensembl: ENSPPYG00000004604
LinkDB
Position
12
AA seq 1098 aa
MPPRQPPRQAGGGLSREFGKLLPALSHSPLGGLGSGSGSVAPGQGRAGAMGSRTSESPLH
AVQLRWGPRRRPPLLPLLLLLLPPPPRVGGFNLDAEAPAVLSGPPGSFFGFSVEFYRPGT
DGVSVLVGAPKANTSQPGVLQGGAVYLCPWGASPTQCTPIEFDSKGSRLLESSLSSSEGE
EPVEYKSLQWFGATVRAHGSSILACAPLYSWRTEKEPLSDPVGTCYLSTDNFTRILEYAP
CRSDFSWAAGQGYCQGGFSAEFTKTGRVVLGGPGSYFWQGQILSATQEQIAESYYPEYLI
NLVQGQLQTRQASSIYDDSYLGYSVAVGEFSGDDTEDFVAGVPKGNLTYGYVTILNGSDI
RSLYNFSGEQMASYFGYAVTATDINGDGLDDLLVGAPLLMDRTPDGRPQEVGRVYIYLQH
PAGIEPTPTLTLTGHDEFGRFGSSLTPLGDLDQDGYNDVAIGAPFGGETQQGVVFVFPGG
PGGLGSKPSQVLQPLWAASHTPDFFGSALRGGRDLDGNGYPDLIVGSFGVDKAVVYRGRP
IVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSIGFTVELQLDWQ
KQKGGVRRALFLASRQATLTQTLLIQNGAREDCREMKIYLRNESEFRDKLSPIHIALNFS
LDPQAPVDSHGLRPALHYHSNSRIEDKAQILLDCGEDNICVPDLQLEVFGEQNHVYLGDK
NALNLTFHAQNVGEGGAYEAELRVTAPPEAEYSGLVRHPGNFSSLSCDYFAVNQSRLLVC
DLGNPMKAGASLWGGLRFTVPHLRDTKKTIQFDFQILSKNLNNSQSDVVSFRLSVEAQAQ
VTLNGVSKPEAVLFPVSDWHPRDQPQKEEDLGPAVHHVYELINQGPSSISQGVLELSCPQ
ALEGQQLLYVTRVMGLNCTTNHPINPKGLELDPEGSLHHRQKREAPSRSSASSGPQILKC
PEAECFRLRCELGPLHQQESQSLQLHFRVWAKTFLQREHQPFSLQCEAVYKALKMPYRIL
PQQLPQKERHVATAVQWTKAEGSHGVPLWIIILAILFGLLLLGLLIYILYKLGFFKRSLP
YGTAMEKAQLKPPATSDA
NT seq 3297 nt   +upstreamnt  +downstreamnt
atgcccccccgccagccccctcggcaggcggggggagggctcagccgggagtttggcaaa
ctcctccccgcgttgagtcattcgcctctgggaggtttaggaagcggctccgggtcggtg
gccccaggacagggaagagcgggcgctatggggagccggacgtcagagtcccctctccac
gccgtgcagctccgctggggcccccggcgccgacccccgctgctgccgctgctgttgctg
ctgctgccgccgccacccagggtcgggggcttcaacttagacgcggaggccccagcagtg
ctctcggggcccccgggctccttcttcggattctcagtggagttttaccggccgggaaca
gacggggtcagtgtgctggtgggagcacccaaggctaacaccagccagccaggagtgctg
cagggtggtgctgtctacctctgtccttggggtgccagccccacacagtgcacccccatt
gaatttgacagcaaaggctctcggctcctggagtcctcactgtccagctcagagggagag
gagcctgtggagtacaagtccttgcagtggttcggggcaacagttcgagcccatggctcc
tccatcttggcatgcgctccactgtacagctggcgcacagagaaggagccactgagcgac
cccgtgggcacctgctacctctccacagacaacttcactcgaattctggagtatgcaccc
tgccgctcagatttcagctgggcagcaggacagggttactgccaaggaggcttcagcgcc
gagttcaccaagactggccgtgtggttttaggtggaccaggaagctatttctggcaaggc
cagatcctgtctgccactcaggagcagattgcagaatcttattaccccgagtacctgatc
aacctggttcaggggcagctgcagactcgccaggccagttccatctatgatgacagctac
ctaggatactctgtggctgtgggtgaattcagtggtgatgacacagaagactttgttgct
ggtgtgcccaaagggaacctcacttacggctatgtcaccatccttaatggctcagacatc
cgatccctctacaacttctcaggggaacagatggcctcctactttggctatgcagtgact
gccacagacatcaatggggatgggctggatgacttgctggtgggggcacccctgctcatg
gatcggacccctgacgggcggcctcaggaggtgggcagggtctacatctacctgcagcac
ccagccggcatagagcccacgcccacccttaccctcactggccatgatgagtttggtcga
tttggcagctccttgacccccctgggggacctggaccaggatggctacaatgatgtggcc
atcggggctccctttggtggggagacccagcagggagtagtgtttgtattccctgggggc
ccaggagggctgggctctaagccttcccaggttctgcagcccctgtgggcagccagccac
accccagacttctttggctctgcccttcgaggaggccgagacctggatggcaacggatac
cctgatctgattgtggggtcctttggtgtggacaaggctgtggtatacagaggccgcccc
atcgtgtccgccagtgcctccctcaccatcttccctgccatgttcaacccagaggagcgc
agctgcagcttagaggggaaccctgtggcctgcatcaaccttagcttctgcctcaatgct
tctggaaaacacgttgctgactccattggcttcacagtggaacttcagctggactggcag
aagcagaagggaggggtacggcgggcactgttcctggcctccaggcaggcaaccctgacc
cagaccctgctcatccagaatggggctcgagaggattgcagagagatgaagatctacctc
aggaacgagtcagaatttcgagacaaactctccccgattcacatcgctctcaacttctcc
ttggacccccaagccccagtggacagccacggcctcaggccagccctacattaccacagc
aacagccggatagaggacaaggctcagatcttgctggactgtggagaagacaacatctgt
gtgcctgacctgcagctggaggtgtttggggagcagaaccatgtgtacctgggtgacaag
aatgccctgaacctcactttccatgcccagaatgtgggtgagggtggcgcctatgaggct
gagcttcgggtcaccgcccctccagaggctgagtactcaggactcgtcagacacccaggg
aacttctccagcctgagctgtgactactttgccgtgaaccagagccgcctgctggtgtgt
gacctgggcaaccccatgaaggcaggagccagtctgtggggtggccttcggtttacagtc
cctcatctccgggacactaagaaaaccatccagtttgacttccagatcctcagcaagaat
ctcaacaactcgcaaagcgacgtggtttccttccggctctccgtggaggctcaggcccag
gtcaccctgaacggtgtctccaagcctgaggcagtgctattcccagtaagcgactggcat
ccccgagaccagcctcagaaggaggaggacctggggcctgctgtccaccatgtctatgag
ctcatcaaccaaggccccagctccattagccagggcgtgctggagctcagctgtccccag
gctctggaaggtcagcagctcctatatgtgaccagagttatgggactcaactgcaccacc
aatcaccccattaacccaaagggcctggagttggatcccgagggttccctgcaccaccgg
caaaaacgggaagctccaagccgcagctctgcttcctcgggacctcagatcctgaaatgc
ccggaggctgagtgtttcaggctgcgctgtgagctcgggcccctgcaccaacaagagagc
caaagtctgcagttgcatttccgagtctgggccaagactttcttgcagcgggagcaccag
ccatttagcctgcagtgtgaggctgtgtacaaagccctgaagatgccctaccgaatcctg
cctcagcagctgccccaaaaggagcgtcatgtggccacagctgtgcaatggaccaaggca
gaaggcagccatggtgtcccactgtggatcatcatcctagccattctatttggcctcctg
ctcctaggtctactcatctacatcctctacaagctcggattcttcaaacgctccctccca
tatggcaccgccatggaaaaagctcagctcaagcctccagccacctctgatgcctga

DBGET integrated database retrieval system