KEGG   Pongo abelii (Sumatran orangutan): 100454013
Entry
100454013         CDS       T01416                                 

Gene name
SRD5A2
Definition
(RefSeq) 3-oxo-5-alpha-steroid 4-dehydrogenase 2
  KO
K12344  3-oxo-5-alpha-steroid 4-dehydrogenase 2 [EC:1.3.1.22]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00140  Steroid hormone biosynthesis
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100454013 (SRD5A2)
 09160 Human Diseases
  09162 Cancer: specific types
   05215 Prostate cancer
    100454013 (SRD5A2)
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100454013 (SRD5A2)
SSDB
Motif
Pfam: Steroid_dh DUF1295 PEMT
Other DBs
NCBI-GeneID: 100454013
NCBI-ProteinID: XP_024098338
LinkDB
Position
2A
AA seq 254 aa
MQVQCQQSPVLAGSATLVALGALALYVAKPSGYGKHTESLMPAATRLPARAAWFLQELPS
FAVPAGILAWQPLSLFGPPGTVLLGLFCVHYFHRTFVYSLLSRGRPYPAILILRGIAFCT
GNGVLQGYYLIYCAEYPDGWYTDIRFSLGVFLFILGMGINIHSDYILRQLRKPGEISYRI
PQGGLFTYVSGANFLGEIIEWIGYALATWSLPALAFAFFSLCFLGLRAFHHHRFYLKMFE
DYPKSRKALIPFIF
NT seq 765 nt   +upstreamnt  +downstreamnt
atgcaggttcagtgccagcagagcccagtgctggcaggcagcgccactttggtcgccctt
ggggcactggccttgtacgtcgcgaagccctccggctacgggaagcacacggagagcctg
atgccggcggctacccgcctgccagcccgcgccgcctggttcctgcaggagctgccctcc
ttcgcggtgcccgcggggatcctcgcctggcagcccctctccctcttcgggccacctggg
acggtgcttctgggcctcttctgcgtacattacttccacaggacatttgtgtactcactg
ctcagtcgagggaggccttatccagctatactcattctcagaggcattgccttctgcact
ggaaatggagtccttcaaggctactatctgatttattgtgctgaataccctgatgggtgg
tacacagacatacggtttagcttgggtgtcttcttatttattttgggaatgggaatcaac
attcatagtgactatatattgcgccagctcaggaagcctggagaaatcagctacaggatt
ccacaaggtggcttgtttacgtatgtttctggagccaatttcctcggtgagatcattgaa
tggatcggctatgccctggccacttggtccctcccagcacttgcctttgcatttttctca
ctttgtttccttgggctgcgagcttttcaccaccataggttctacctcaagatgttcgag
gactaccccaaatctcggaaagcccttattccattcatcttttaa

DBGET integrated database retrieval system