KEGG   Pongo abelii (Sumatran orangutan): 100454099
Entry
100454099         CDS       T01416                                 

Gene name
DDB2
Definition
(RefSeq) DNA damage-binding protein 2 isoform X1
  KO
K10140  DNA damage-binding protein 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03420  Nucleotide excision repair
pon04115  p53 signaling pathway
pon04120  Ubiquitin mediated proteolysis
pon05161  Hepatitis B
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05216  Thyroid cancer
pon05217  Basal cell carcinoma
pon05218  Melanoma
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    100454099 (DDB2)
  09124 Replication and repair
   03420 Nucleotide excision repair
    100454099 (DDB2)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    100454099 (DDB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454099 (DDB2)
   05202 Transcriptional misregulation in cancer
    100454099 (DDB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100454099 (DDB2)
   05212 Pancreatic cancer
    100454099 (DDB2)
   05225 Hepatocellular carcinoma
    100454099 (DDB2)
   05226 Gastric cancer
    100454099 (DDB2)
   05214 Glioma
    100454099 (DDB2)
   05216 Thyroid cancer
    100454099 (DDB2)
   05220 Chronic myeloid leukemia
    100454099 (DDB2)
   05217 Basal cell carcinoma
    100454099 (DDB2)
   05218 Melanoma
    100454099 (DDB2)
   05213 Endometrial cancer
    100454099 (DDB2)
   05224 Breast cancer
    100454099 (DDB2)
   05222 Small cell lung cancer
    100454099 (DDB2)
   05223 Non-small cell lung cancer
    100454099 (DDB2)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100454099 (DDB2)
   05169 Epstein-Barr virus infection
    100454099 (DDB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:pon04121]
    100454099 (DDB2)
   03400 DNA repair and recombination proteins [BR:pon03400]
    100454099 (DDB2)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul4 complex
    Target recognizing subunit (DCAF)
     100454099 (DDB2)
DNA repair and recombination proteins [BR:pon03400]
 Eukaryotic type
  SSBR (single strand breaks repair)
   NER (nucleotide excision repair)
    GGR (global genome repair) factors
     Cul4-DDB2 complex
      100454099 (DDB2)
SSDB
Motif
Pfam: WD40 Ge1_WD40
Other DBs
NCBI-GeneID: 100454099
NCBI-ProteinID: XP_002821864
Ensembl: ENSPPYG00000003311
UniProt: H2NDJ7 A0A663D9Z0
LinkDB
Position
11
AA seq 427 aa
MAPKKRPETQKTSEIVLRPRNMRSRSPRELEPEAKKLCAKGSGPSRRCDSDCLWAGLAGP
QILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWH
PTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGT
TRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRM
HKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDG
ARLLTTDQKSEIRVYSASQWDCPLGLIPHPHRHFQHLTPIKAAWHPRYNLIVVGRYPDPN
FKSCTPYELRTIDVFDGNSGKMMCQLYDPESSGISSLNEFNPMGDTLASAMGYHVLIWSQ
EEARTRK
NT seq 1284 nt   +upstreamnt  +downstreamnt
atggctcccaagaaacgcccagaaacccagaagacctccgagattgtattacgccccagg
aacatgaggagcaggagtccccgggagctggagcccgaggccaagaagctctgtgcgaag
ggctccggtcctagcagaagatgtgactcagactgcctctgggcggggctggctggccca
cagatcctgccaccatgccgcagcatcgtcaggaccctccaccagcataagctgggcaga
gcttcctggccatctgtccagcaggggctccagcagtcctttttgcacactctggattct
taccggatattacaaaaggctgccccctttgataggagggctacatccttggcgtggcac
ccgactcaccccagcaccgtggctgtgggttccaaagggggagatatcatgctctggaat
tttggcatcaaggacaaacccaccttcatcaaagggattggagctggagggagcatcact
gggctgaagtttaaccctctcaataccaaccagttttacgcctcctcaatggagggaaca
actaggctgcaagactttaaaggcaacattctacgagtttttgccagctcagacaccatc
aacatctggttttgtagcctggatgtgtctgctagtagccgaatggtggtcacaggagac
aacgtggggaatgtgatcctgctgaacatggacggcaaagagctttggaatctcagaatg
cacaaaaagaaagtgacgcatgtggccctgaacccatgctgtgattggttcctggccaca
gcctccgtagatcaaacagtgaaaatttgggatctgcgccaggttagagggaaagccagc
ttcctctactcgctgccgcacaggcatcctgtcaacgcagcttgtttcagtcccgatgga
gcccggctcctgaccacagaccagaagagcgagatccgagtttactctgcttcccagtgg
gactgccccctgggcctgatcccgcaccctcaccgtcacttccagcacctcacacccatc
aaggcagcctggcatcctcgctacaacctcattgtcgtgggccgatacccagaccctaat
ttcaaaagctgtaccccttatgaattgaggacgatcgatgtgttcgatggaaactcaggg
aagatgatgtgtcagctctatgacccagaatcttctggcatcagttcgcttaatgagttc
aatcccatgggggacacgctggcctctgcaatgggttaccacgttctcatctggagccag
gaggaagccaggacacggaaatga

DBGET integrated database retrieval system