KEGG   Pongo abelii (Sumatran orangutan): 100454123
Entry
100454123         CDS       T01416                                 

Gene name
ZBTB17
Definition
(RefSeq) zinc finger and BTB domain-containing protein 17 isoform X1
  KO
K10500  zinc finger and BTB domain-containing protein 17
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04110  Cell cycle
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100454123 (ZBTB17)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100454123 (ZBTB17)
   05202 Transcriptional misregulation in cancer
    100454123 (ZBTB17)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100454123 (ZBTB17)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100454123 (ZBTB17)
   04121 Ubiquitin system [BR:pon04121]
    100454123 (ZBTB17)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys2His2 BTB-ZF factors
    100454123 (ZBTB17)
Ubiquitin system [BR:pon04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     100454123 (ZBTB17)
SSDB
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 BTB zf-C2H2_jaz zf-C2H2_11 zf-met zf-H2C2_5 zf-C2H2_6 zinc_ribbon_15 Zn-ribbon_8 zf-C2HC_2 zf-BED zf_UBZ zf-C2HE zf-Di19 XPA_N HypA DUF3268
Other DBs
NCBI-GeneID: 100454123
NCBI-ProteinID: XP_002811479
Ensembl: ENSPPYG00000001833
UniProt: A0A663D9Q5 H2N8Y5
LinkDB
Position
1
AA seq 807 aa
MDFPQHSQHVLEQLNQQRQLGLLCDCTFVVDGVHFKAHKAVLAACSEYFKMLFVDQKDVV
HLDISNAAGLGQVLEFMYTAKLSLSPENVDDVLAVATFLQMQDIITACHALKSLAEPATS
PGGNAEALATEGGDKRAKEEKAATSTLSRLEQAGRSAPTGPSRDLKEERGGQAQSAASGA
EQTEKADAPREPLPVELKPDPTSGMAAAEAEAALSESSEQEMEVEPARKGEEEQEEQEEE
GAGPAEVKEEGSHLQNGEAPEENENEESAGTDSGQELGSEARGLRSGTYGDRTESKAYGS
VIHKCEDCGKEFTHTGNFKRHIRIHTGEKPFSCRECSKAFSDPAACKAHEKTHSPLKPYG
CEECGKSYRLISLLNLHKKRHSGEARYRCEDCGKLFTTSGNLKRHQLVHSGEKPYQCDYC
GRSFSDPTSKMRHLETHDTDKEHKCPHCDKKFNQVGNLKAHLKIHIADGPLKCRECGKQF
TTSGNLKRHLRIHSGEKPYVCIHCQRQFADPGALQRHVRIHTGEKPCQCVMCGKAFTQAS
SLIAHVRQHTGEKPYVCERCGKRFVQSSQLANHIRHHDNIRPHKCSVCSKAFVNVGDLSK
HIIIHTGEKPYLCDKCGRGFNRVDNLRSHVKTVHQGKAGIKILEPEEGSEVSVVTVDDMV
TLATEALAATAVTQLTGPATLPAVVPVGAAVTADETEVLKAEISKAVKQVQEEDPNTHIL
YACDSCGDKFLDANSLAQHVRIHTAQALVMFQTDADFYQQYGPGGTWPAGQVLQAGELVF
RPRDGAEGQPALAETSPTAPECPPPAE
NT seq 2424 nt   +upstreamnt  +downstreamnt
atggactttccccagcacagccagcacgtcttggaacagctgaaccagcagcggcagctg
gggcttctctgtgactgcacctttgtggtggacggtgttcactttaaggctcataaagca
gtgctggcggcctgcagcgagtacttcaagatgctcttcgtggaccagaaggacgtggtg
cacctggacatcagtaacgcggcaggcctggggcaggtgctggagtttatgtacacggcc
aagctgagcctgagccctgagaacgtggatgatgtgctggccgtggccactttcctccaa
atgcaggacatcatcacggcctgccatgccctcaagtcacttgctgagccggctaccagc
cctgggggaaatgcggaggccttggccacagaaggaggggacaagagagccaaagaggag
aaggcggccaccagcacactaagcaggctggagcaggcgggacgcagtgcacccacaggc
cccagcagggacctcaaggaggagcgcggcggtcaggcccagagtgcggccagcggtgca
gagcagacagagaaagccgatgcgccccgggagccgctgcctgtggagctcaagccagac
cccacgagtggcatggctgccgcagaagctgaggctgctttgtccgagagctcggagcaa
gaaatggaggtggagcccgcccggaaaggggaagaggagcaagaggagcaagaggaggag
ggcgcagggccagctgaggtcaaggaggagggttcccatctgcagaacggagaggccccc
gaggagaacgagaacgaggagtcagcgggcacagactcggggcaggagctcggctccgag
gcccggggcctgcgctcaggcacctacggcgaccgcacggagtccaaggcctacggctcc
gtcatccacaagtgcgaggactgtgggaaggagttcacgcacacggggaacttcaagcgg
cacatccgcatccatacgggggagaagcccttctcgtgccgggagtgcagcaaggccttt
tccgacccggccgcgtgcaaggcccatgagaagacgcacagccctctgaagccgtacggc
tgcgaggagtgcgggaagagctaccgcctcatcagcctgctcaacctgcacaagaagcgg
cactcgggcgaggcgcgctaccgctgcgaggactgcggcaagctcttcaccacctcgggc
aacctcaagcgccaccagctggtgcatagcggcgagaagccctaccagtgcgactactgc
ggccgctccttctccgaccccacttccaagatgcgccacctggagacccacgacacggac
aaggagcacaagtgcccacactgcgacaagaagttcaaccaggtagggaacctgaaggcc
cacctgaagatccacatcgctgacgggcccctcaagtgccgagagtgtgggaagcagttc
accacctcagggaacctgaagcggcaccttcggatccacagcggggagaaaccctacgtg
tgcatccactgccagcgacagtttgcagaccccggcgctctgcagcggcacgtccgcatt
cacacaggtgagaagccgtgccagtgtgtgatgtgcggtaaggccttcacccaggccagc
tccctcatcgcccacgtgcgccagcacaccggggagaagccctacgtctgcgagcgctgc
ggcaagagattcgtccagtccagccagttggccaatcatattcgccaccacgacaacatc
cgcccacacaagtgcagcgtgtgcagcaaggccttcgtgaacgtgggggacctgtccaag
cacatcatcattcacactggagagaagccttacctgtgtgataagtgtgggcgtggcttc
aaccgggtagacaacctgcgctcccacgtgaagaccgtgcaccagggcaaggcaggcatc
aagatcctggagcccgaggagggcagtgaggtcagcgtggtcactgtggatgacatggtc
acgctggccaccgaggcactggcagcaacagccgtcactcagctcacaggccctgcgact
ctgcccgcagtggtgccagtgggagctgcagtgacagccgatgagacggaagtcctgaag
gccgagatcagcaaagctgtgaagcaagtacaggaagaagaccccaacactcacatcctc
tacgcctgtgactcctgtggggacaagtttctggatgccaacagcctggctcagcacgtg
cgaatccacacagcccaggcactggtcatgttccagacagacgcggacttctatcagcag
tatgggccaggtggcacgtggcctgccgggcaggtgctgcaggctggggagctggtcttc
cgccctcgggacggggccgagggccagcccgcactggcagagacctcccctacagctcct
gaatgtcccccgcctgccgagtga

DBGET integrated database retrieval system