KEGG   Pongo abelii (Sumatran orangutan): 100454976
Entry
100454976         CDS       T01416                                 

Gene name
BMF
Definition
(RefSeq) bcl-2-modifying factor isoform X3
  KO
K17460  Bcl-2-modifying factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100454976 (BMF)
SSDB
Motif
Pfam: BMF
Other DBs
NCBI-GeneID: 100454976
NCBI-ProteinID: XP_002825331
Ensembl: ENSPPYG00000006344
UniProt: A0A6D2XBX1 A0A2J8T301
LinkDB
Position
15
AA seq 184 aa
MEPSQCVEELEDDVFQPEDGEPGTQSGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGL
RPTSQEDKATQTLSPASPSQGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPTGEQP
PEGQWQHRAEVQIARKLQCIADQFHRLHVQQHQQNRNRVWWQILLFLHNLALNGEENRNG
AGPR
NT seq 555 nt   +upstreamnt  +downstreamnt
atggagccatctcagtgtgtggaggagctggaggatgatgtgttccaaccagaggatggg
gagccggggacccaatccggaagcttgctctctgctgacctgtttgcccagagcctactg
gactgccccctcagccgacttcagctcttccctctcacccactgctgtggccctggcctt
cgacccaccagccaggaagacaaagctacccagaccctcagcccagcctcccccagccaa
ggtgtcatgctgccttgtggggtgactgaggaaccccagcgactcttttatggcaatgct
ggctaccggcttcctctccctgccagtttcccggcagtcttgcctactggggagcagccc
cctgaagggcagtggcaacatcgagcagaggtacagattgcccgaaagcttcagtgcatt
gcagaccagttccaccggcttcatgtgcagcaacaccagcagaaccgaaatcgcgtgtgg
tggcagatcctcctcttcctgcacaaccttgctttgaatggagaagagaacaggaacggg
gcaggccctaggtga

DBGET integrated database retrieval system