KEGG   Pongo abelii (Sumatran orangutan): 100455214Help
Entry
100455214         CDS       T01416                                 

Gene name
TUFM
Definition
(RefSeq) elongation factor Tu, mitochondrial
  KO
K02358  elongation factor Tu
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Translation factors [BR:pon03012]
 Eukaryotic Type
  Elongation factors
   100455214 (TUFM)
 Prokaryotic Type
   100455214 (TUFM)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    100455214 (TUFM)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100455214 (TUFM)
  Exosomal proteins of breast cancer cells
   100455214 (TUFM)
  Exosomal proteins of colorectal cancer cells
   100455214 (TUFM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 100455214
NCBI-ProteinID: XP_002826324
Ensembl: ENSPPYG00000007226
UniProt: H2NQI4
LinkDB All DBs
Position
16
AA seq 455 aa AA seqDB search
MTTMAAATLLRATPHFSGLAAGRTFLLQGLLRPLKAPALPLLCRGLAVEAKKTYVRDKPH
VNVGTIGHVDHGKTTLTAAITKILAEGGGAKFKKYEEIDNAPEERARGITINAAHVEYST
AARHYAHTDCPGHADYVKNMITGTAPLDGCILVVAANDGPMPQTREHLLLARQVGVEHVV
VYVNKADAVQDSEMVELVELEIRELLTEFGYKGEETPVIVGSALCALEGGDPELGLKSVQ
KLLDAVDTYIPVPARDLEKPFLLPVEAVYSVPGRGTVVTGTLERGILKKGDECELLGHSK
NIRTVVTGIEMFHKSLERAEAGDNLGALLRGLKREDLRRGLVMVKPGSIKPHQKVEAQVY
ILSKEEGGRHKPFVSHFMPVMFSLTWDMVCRIVLPPEKELAMPGEDLKFNLILRQPMILE
KGQRFTLRDGSRTIGTGLVTDTLAMTEEEKNIKWS
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atgaccacaatggcggccgccaccctgctgcgcgcgacgccccacttcagcggtctcgcc
gccggccggaccttcctgctgcagggtctgttgcggccgctgaaagccccggcattgcct
ctcttgtgccgcggcctggccgtggaggccaagaaaacttacgtgcgcgacaagccacat
gtgaatgtgggtaccatcggccatgtggaccacggcaagaccacgctaactgcagccatt
acgaagattctagccgagggaggtggggctaaattcaagaagtacgaggagattgacaat
gccccggaggagcgagctcggggtatcaccatcaatgcggctcatgtggagtatagcact
gcagcccgccactacgcccatacagactgccccggtcatgcagattatgttaagaatatg
atcacaggcactgcacccctcgacggctgcatcctggtggtagcagccaatgacggcccc
atgccccagacccgagagcacttattactggccagacaggttggagtggagcatgtggta
gtgtatgtgaacaaggctgacgctgtccaggactctgagatggtggagcttgtggaactg
gagatccgggagctgctcaccgagtttggttataaaggggaggagaccccagtcatcgta
ggctctgctctctgtgcccttgagggtggggaccctgagttaggcctgaagtctgtgcag
aagctactggatgctgtggacacttacatcccagtgcccgcccgggacctggagaagcct
ttcctgctgcctgtagaggcggtgtactccgtccctggccgtggcaccgtggtgacaggt
acactagagcgtggcattttaaagaagggagacgagtgtgagctcctaggacatagcaag
aacatccgcactgtggtgacaggcattgagatgttccacaagagcctggagagggccgag
gccggagataaccttggggccctgctccgaggcttgaagcgggaggacttgcggcggggc
ctggtcatggtcaagccgggttccatcaagccccaccagaaggtggaggctcaggtttac
atcctcagcaaggaggaaggtggccgccacaagccctttgtgtcccacttcatgcctgtc
atgttctccctgacttgggacatggtctgtcggattgtcctgcccccagagaaggagctt
gccatgcccggggaggacctgaaattcaacctaatcttgcggcagccaatgatcttagag
aaaggccagcgtttcaccctgcgagatggcagccggactattggcaccggtctagtcacc
gacacgctggccatgactgaggaggagaagaacatcaagtggagttga

DBGET integrated database retrieval system