KEGG   Pongo abelii (Sumatran orangutan): 100455248
Entry
100455248         CDS       T01416                                 

Gene name
IL2
Definition
(RefSeq) interleukin-2
  KO
K05429  interleukin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04151  PI3K-Akt signaling pathway
pon04625  C-type lectin receptor signaling pathway
pon04630  JAK-STAT signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04672  Intestinal immune network for IgA production
pon04940  Type I diabetes mellitus
pon05135  Yersinia infection
pon05142  Chagas disease
pon05162  Measles
pon05166  Human T-cell leukemia virus 1 infection
pon05200  Pathways in cancer
pon05320  Autoimmune thyroid disease
pon05321  Inflammatory bowel disease
pon05330  Allograft rejection
pon05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100455248 (IL2)
   04151 PI3K-Akt signaling pathway
    100455248 (IL2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100455248 (IL2)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100455248 (IL2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100455248 (IL2)
   04660 T cell receptor signaling pathway
    100455248 (IL2)
   04658 Th1 and Th2 cell differentiation
    100455248 (IL2)
   04659 Th17 cell differentiation
    100455248 (IL2)
   04672 Intestinal immune network for IgA production
    100455248 (IL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455248 (IL2)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    100455248 (IL2)
   05321 Inflammatory bowel disease
    100455248 (IL2)
   05330 Allograft rejection
    100455248 (IL2)
   05332 Graft-versus-host disease
    100455248 (IL2)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    100455248 (IL2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    100455248 (IL2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100455248 (IL2)
   05162 Measles
    100455248 (IL2)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    100455248 (IL2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100455248 (IL2)
   00536 Glycosaminoglycan binding proteins [BR:pon00536]
    100455248 (IL2)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  Interleukins
   100455248 (IL2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Haparin
  Cytokines
   100455248 (IL2)
SSDB
Motif
Pfam: IL2 Plasmid_RAQPRD
Other DBs
NCBI-GeneID: 100455248
NCBI-ProteinID: XP_002815161
Ensembl: ENSPPYG00000015043
UniProt: A0A6D2XRS9 H2PE89
LinkDB
Position
4
AA seq 153 aa
MYRMQLLSCIALSLALVTNSAPTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRML
TFKFYMPKKATELKHLQCLEEELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSE
TTFMCEYADETATIVEFLNRWITFCQSIISTLT
NT seq 462 nt   +upstreamnt  +downstreamnt
atgtacaggatgcaactcctgtcttgcattgcactaagtcttgcacttgtcacaaacagt
gcacctacttcaagttctacaaagaaaacacagctacaactggagcatttactgctggat
ttacagatgattttgaatggaattaataattacaagaatcccaaactcaccaggatgctc
acatttaagttttacatgcccaagaaggccacagaattgaaacatcttcagtgtctagaa
gaagaactcaaacctctggaggaagtgctaaatttagctcaaagcaaaaactttcactta
agacccagggacttaatcagcaatatcaatgtaatagttctggaactaaagggatctgaa
acaacattcatgtgtgaatatgctgatgagacagcaaccattgtagaatttctgaacaga
tggattaccttttgtcaaagcatcatctcaacactgacttga

DBGET integrated database retrieval system