KEGG   Pongo abelii (Sumatran orangutan): 100455339Help
Entry
100455339         CDS       T01416                                 

Gene name
GANC
Definition
(RefSeq) neutral alpha-glucosidase C isoform X1
  KO
K12317  neutral alpha-glucosidase C [EC:3.2.1.20]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100455339 (GANC)
   00500 Starch and sucrose metabolism
    100455339 (GANC)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100455339 (GANC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100455339
NCBI-ProteinID: XP_024088268
LinkDB All DBs
Position
15
AA seq 914 aa AA seqDB search
MEAAVKEEISVEDEAVDKNIFRDCNNIAFYRRQKQWLSKKSTYQALLDSVTTDEDSTRFQ
IINEASKVPLLAEICGIEGNIFRLKINEETPLKPRFEVPDVLTSKPSTVRLISCSGDTGS
LILADGKGDLKCHVTANPFKVDLVSEEEVVISINSLGQLYFEHLQILHKQRAAKENEEEA
SVDTSQENQEDLGLWEEKFGKFVDIKANGPSSIGLDFSLHGFEHLYGIPQHAESHQLKNT
GDGDAYRLYNLDVYGYQIYDKMGIYGSVPYLLAHKLGRTIGIFWLNASETLVEINTEPAV
EYTLTQMGPVAAKQKVRSRTHVHWMSESGIIDVFLLTGPTPSDVFKQYSHLTGTQAMPPL
FSLGYHQCRWNYEDEQDVKAVDAGFDEHDIPYDAMWLDIEHTEGKRYFTWDKNRFPNPER
MQELLRSKKRKLVVISDPHIKIDPDYSVYVKAKDQGFFVKNQEGEDFEGVCWPGLSSYLD
FTNPKVREWYSSLFAFPVYQGSTDILFLWNDMNEPSVFRGPEQTMQKNAIHHGNWEHREL
HNIYGFYHQMATAEGLIQRSKGKERPFVLTRSFFAGSQKYGAVWTGDNTAEWSNLKISIP
MLLTLSITGISFCGADIGGFIGNPETELLVRWYQAGAYQPFFRGHATMNTKRREPWLFGE
EYTRLIREAIRERYGLLPYWYSLFYHAHVASQPVMRPLWVEFPDELKTFDMEDEYMLGSA
LLVHPVTEPKATAVDVFLPGSNEVWYDYKTFAHWEGGCTVKIPVALDTIPVFQRGGSVIP
IKTTVGKSTGWMTESSYGLRVALSTKASSVGELYLDDGHSFQYLHQKQFLHRKFSFCSSV
LINSSADQRGHYPSKCVVEQILVLGFRKEPSSVTTHSSDGKDQPVAFTYCTKTSTLSLEK
LSLNIATDWEVRII
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggaagcagctgtgaaagaggaaataagtgttgaagatgaagctgtagataaaaacatt
ttcagagactgtaacaacattgcattttacaggcgtcagaaacagtggctttccaagaag
tccacctatcaggcattactggactcagtcacaacagatgaagacagcaccaggttccaa
atcatcaatgaagcaagtaaggttcctctcctggctgaaatttgtggtatagaaggaaac
attttcaggcttaaaattaacgaagagactcctctaaaacccaggtttgaagttcctgat
gtcctcacaagcaagccaagcactgtaaggctgatttcatgctcaggggacacaggcagt
ctgatattggcagatggaaaaggagacctgaagtgccatgtcacagcaaacccattcaaa
gtagacttggtgtctgaagaagaggttgtgattagcataaattccctgggccaattatat
tttgagcatctacagattcttcacaaacaaagagctgctaaagaaaatgaggaggaggca
tcagtggacacctctcaggaaaatcaagaagatctgggcctgtgggaagagaaatttgga
aaatttgtggatatcaaagctaatggcccttcttctattggtttggatttctccttgcat
ggatttgagcatctttatgggatcccacaacatgcagaatcacaccaacttaaaaatact
ggtgacggagatgcttaccgtctttataacctggatgtctatggataccaaatatatgat
aaaatgggcatttatggttcagtaccttatctcctggcccacaaactgggcagaactata
ggtattttctggctgaatgcctcagaaacactggtggagatcaatacagagcctgcagta
gagtacacactgacccagatgggcccagttgctgctaaacaaaaggtcagatctcgcact
catgtgcactggatgtcagagagtggcatcattgatgtttttctgctgacaggacctaca
ccttctgatgtcttcaaacagtactcacaccttacaggcacacaagccatgccccctctt
ttctctttgggatatcaccagtgccgctggaactatgaagatgagcaggatgtaaaagca
gtggatgcagggtttgatgagcatgacattccttatgatgccatgtggctggacatagag
cacactgagggcaagaggtacttcacctgggacaaaaacagattcccaaaccccgagagg
atgcaagagctgctcaggagcaaaaagcgtaagcttgtggtcatcagtgatccccacatc
aagattgatcctgactactcagtatatgtgaaggccaaagatcagggcttctttgtgaag
aatcaggaaggggaagactttgaaggggtgtgttggccaggtctctcctcttacctggat
ttcaccaatcccaaggtcagagagtggtattcaagtctttttgctttccctgtttatcag
ggatctacggacatcctcttcctttggaatgacatgaatgagccttctgtctttagaggg
ccagagcaaaccatgcagaagaatgccattcatcatggcaattgggagcacagagaactc
cacaacatctacggtttttatcatcaaatggctactgcagaaggactgatacaacgatct
aaagggaaggagagaccctttgttcttacacgttctttctttgctggatcacaaaagtat
ggtgccgtgtggacaggcgacaacacagcagaatggagcaacttgaaaatttctatccca
atgttactcactctcagcattactgggatctctttttgtggagctgacataggcgggttc
attgggaatccagagacagagctgctagtgcgttggtaccaggccggagcctaccagccc
ttcttccgtggccatgccaccatgaacaccaagcgacgagagccctggctctttggggag
gaatacacccgactcatccgagaagccatcagagagcgctatggcctcctgccatattgg
tattctctgttctaccatgcacacgtggcttcccaacctgtcatgaggcctctgtgggta
gagttccctgatgaactaaagacttttgatatggaagatgaatacatgctggggagtgca
ttattggttcatccagtcacagaaccaaaagccaccgcagttgatgtgtttcttccagga
tcaaatgaggtctggtatgactataagacatttgctcattgggaaggagggtgtactgta
aagatcccagtagccttggacactattccagtgtttcagcgaggtggaagtgtgatacca
ataaagacaactgtaggaaaatccacaggctggatgaccgaatcctcctatggactccgg
gttgctctaagcactaaggcttcttcagtgggtgagttatatcttgacgatggccattca
ttccaatacctccaccagaagcaatttttgcacaggaagttttcattctgttccagtgtt
ctgatcaatagttctgctgaccagaggggtcattatcccagcaagtgtgtggtggagcag
atcttggtcttaggcttcaggaaggagccatcttctgtgactacccactcatctgatggt
aaagatcagcctgtggcttttacgtattgtaccaaaacatccaccctgagcctggagaag
ctctcgctcaacattgccactgactgggaggtccgcatcatatga

DBGET integrated database retrieval system