KEGG   Pongo abelii (Sumatran orangutan): 100455587
Entry
100455587         CDS       T01416                                 

Gene name
CD19
Definition
(RefSeq) B-lymphocyte antigen CD19 isoform X2
  KO
K06465  B-lymphocyte antigen CD19
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04640  Hematopoietic cell lineage
pon04662  B cell receptor signaling pathway
pon05169  Epstein-Barr virus infection
pon05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100455587 (CD19)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100455587 (CD19)
   04662 B cell receptor signaling pathway
    100455587 (CD19)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    100455587 (CD19)
  09172 Infectious disease: viral
   05169 Epstein-Barr virus infection
    100455587 (CD19)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100455587 (CD19)
CD molecules [BR:pon04090]
 Proteins
  100455587 (CD19)
SSDB
Motif
Pfam: Ig_3 V-set
Other DBs
NCBI-GeneID: 100455587
NCBI-ProteinID: XP_002826325
Ensembl: ENSPPYG00000007223
UniProt: H2NQI1 A0A663DIG7
LinkDB
Position
16
AA seq 557 aa
MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWFRESPFKP
FLKLSLGLPGLGIHMRPLAIWLFIFNVSQQMGGFYLCQQGPPSEKAWQPGWTVSVEGSGE
LFRWNVSDLGGLGCGLKNRSSEGPSSPSGKLMSPKLYVWAKDRPKIWEGEPPCGPPRDSL
NQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPEGRKSSLLSLELKDDRPARDM
WVMETGLLLPRATAQDAGKYYCHRGNLTMSFYLEITARPVLWHWLLRTGGWKVSAVTLAY
LIFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTS
GLGRAQRWAAGLGGTAPSYGNPSSDVQADGAVGSRSPPGVGPEEEEGEGYEEPDSEEGSE
FYENDSNLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVARTMDFL
SPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHEEDADSYENMDNPDG
PDPAWGGGGRMGTWSTR
NT seq 1674 nt   +upstreamnt  +downstreamnt
atgccacctcctcgcctcctcttcttcctcctcttcctcacccccatggaagtcaggccc
gaggaacctctagtggtgaaggtggaagagggagataacgctgtgctgcagtgcctcaag
gggacctcagatggccccactcagcagctgacttggtttcgggagtccccgtttaaaccc
ttcttaaaactcagcctggggctgccaggcctgggaatccacatgaggcccctggccatc
tggcttttcatcttcaacgtctctcaacagatggggggcttctacctgtgccagcagggg
cccccctctgagaaggcctggcagcctggctggacagtcagtgtggagggcagcggggag
ctgttccggtggaatgtttcggacctaggtggcctgggctgtggcctgaagaacaggtcc
tcagagggccccagctccccttccgggaagctcatgagccccaagctgtatgtgtgggcc
aaagaccgccctaagatctgggagggagagcctccatgtggcccaccaagggacagcctg
aaccagagcctcagccaggacctcaccatggcccctggctccacactctggctgtcctgt
ggggtaccccctgactctgtgtccaggggccccctctcctggacccatgtgcaccccgag
gggcgtaagtcctcattgctgagcctagagctgaaggacgatcgcccggccagagatatg
tgggtaatggagacgggtctgttgttgccccgggccacagctcaagacgctggaaagtat
tattgtcaccgtggcaacctgaccatgtcattctacctggagatcactgctcggccagta
ctatggcactggctgctgaggactggtggctggaaggtctcagctgtgactttggcttat
ctgatcttctgcctgtgttcccttgtgggcattcttcatcttcaaagagccctggtcctg
aggaggaaaagaaagcgaatgactgaccccaccaggagattcttcaaagtgacgcctccc
ccaggaagcgggccccagaaccagtacgggaacgtgctgtctctccccacacccacctca
ggcctcggacgcgcccagcgttgggccgcaggcctggggggcactgccccgtcttatgga
aacccgagcagcgacgtccaggcggatggagccgtggggtcccggagcccgccgggagtg
ggcccagaagaagaggaaggggagggctatgaggaacctgacagtgaggagggctccgag
ttctatgagaacgactccaaccttgggcaggaccagctctcccaggatggcagtggctat
gagaaccctgaggatgagcccctgggtcctgaggatgaagactccttctccaacgctgag
tcttacgagaacgaggatgaagagctgacccagccggtcgccaggacaatggacttcctg
agccctcatgggtcagcctgggaccccagccgggaagcaacctccctggggtcccagtcc
tacgaggatatgagaggaatcctgtatgcagccccccagctccgctccattcggggccag
cctggacccaatcatgaggaagatgcagactcttatgagaacatggataatcccgacggg
ccagacccagcctggggaggagggggccgcatgggcacctggagcaccaggtga

DBGET integrated database retrieval system