KEGG   Pongo abelii (Sumatran orangutan): 100455657Help
Entry
100455657         CDS       T01416                                 

Gene name
MGAM2
Definition
(RefSeq) putative maltase-glucoamylase-like protein FLJ16351
  KO
K12047  maltase-glucoamylase [EC:3.2.1.20 3.2.1.3]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00052  Galactose metabolism
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04973  Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100455657 (MGAM2)
   00500 Starch and sucrose metabolism
    100455657 (MGAM2)
 09150 Organismal Systems
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    100455657 (MGAM2)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     100455657 (MGAM2)
    3.2.1.20  alpha-glucosidase
     100455657 (MGAM2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Trefoil Gal_mutarotas_2 DUF5110
Motif
Other DBs
NCBI-GeneID: 100455657
NCBI-ProteinID: XP_024105743
LinkDB All DBs
Position
7
AA seq 2516 aa AA seqDB search
MARKLSVLEVLLIIFCLIVVTIDILLLLLVLEETSDTSFTPECPEIPQSERIDCTPDQEV
TEDICRWQYKCCWSPVVDANVPRCFFPWNWGYEASNGHTNTSTGFTAQLKRLPSPSLFGN
DVATTLFTAEYQTSNRFHFKITDFNNIRYEVSHENINLVDGTADASNLSYYVEVTDKPFS
IKIMRTSNRRVLLDTSIGPLQYAQQYLQLSFRLPSANVYGLGEHVHQQYRHNMTWKTWPI
FTRDATPTEGMINLYGAHTFFLCLEDASGSSFGVFLMNSNAMEVTLQPAPAITYRTIGGI
LDFYVFLGNTPEQVVQEYLELVGRPFLPPYWSLGFQLSRRDYGGINKLKEVVSRNRLAEI
PYDVQYSDIDYMDGKKDFTVDEVAYSGLPDFVKELHDNGQKYLIIMNPGISKNSNYEPYN
NGSLKRVWILGNNGFAVGEGYPGPTVFPDYTNPVCTEWWTDQVAKFHDHLEFDGVWIEMN
EVSSLLQASDNQCESNNLNFPPFLPRVLDHLLFARTLCMDTEFHGGLHYDIHSLYGHSMA
RTTNLALETIFMNNRSFILSRSTFAGSGKFAAHWLGDNAATWDDLRWSIPTILEFNLFGI
PMVGANICGYNNNVTEELCRRWMQLGAFYPLPRNHNGPGFRDQDPAAFGADSLLLNSSRH
YLNIRYTLLPYLYTLFYRAHTRGETVARPLVHEFYQDSATWDVHEQFLWGPGLLITPVLY
EGVDEVKAYIPDATWYDYETGVAIPWRKQLVNMLLPGDKIGLHLRGGYIFPTQKPNTTTE
TSRRNSLGLIIALDYKREAKGELYWDDGVSKDAVTEKKYILYDFSVTSNHLQAKIINNNY
MDTDNLMFTDMTILGMDKQPANFIVLVNNVTTSSPSIVYSASTKVVTITDLQGLVLGQEF
SITWHLPVSDLEKFNCYPDNSTASKESCRQRGCLWEDTSTPGVPTCYYDTIPNYVASDIQ
YLNTSITADLSLLMAPESAAAAASDSLSAKISFLHLNVIYHTATMLQVKIYDPTNKRYEV
PVPLNTPPQPVGDPENRLYDVRIQNNPFGIQIQRKNSSTVIWDSQLPGFTFNDMFLSIST
RLPSQYIYGFGETEHTTFRRNMNWNTWGMFSRDEPPTYKKNAYGVHPYYMALEEDGSAHG
VLLLNSNAMDVTLQPTPALTYRTTGGILDFYIVLGPTPELVTQQYTELIGRPAMIPYWAL
GFQLSRYGYQNDAEISSLYDAMVAAQIPYDVQHVDIDYMNRKLDFTLSANFQNLSVLIEQ
MKKNGMRFILILDPAISGNETQYLPFIRGQENNVFIKWPDTNDIVWGKVWPDLPNVIVDG
SLDHETQVKLYRAYVAFPDFFRNSTAAWWKKEIEELYANPREPEKSLKFDGLWIDMNEPS
NFVDGSVRGCSDEMLNNPPYMPYLESRDKGLNSKTLCMESQQILPDSSSVQHYNVHSLYG
WSQTRPTYEAVQEVTGQRGVVITRSTFPSSGRWGGHWLGDNTAEWDQLGKSIIGMMDFSL
FGIPYTGADICGFFGDAEYEMCVRWMQLGAFYPFSRNHNNIGTRRQDPVAWNSTFEMLSR
EVLETRYTLLPYLYTLMHKAHVEGSTVVRPLLHEFTDDRTTWDIDRQFMLGPAILISPVL
ETSTFEVSAYFPRARWYDYSTGTGSKSTGQRKILKAPLDHINLHVRGGYILPWQEPAMNT
HSSRQNFMGLIIALDDNGTAEGQVFWDDGQSIDTYENGNYFLANFIAAQNFLQIQTIHNK
YLSDSNPLKVGYIRIWGVNTYVTQVSYTYDNQQFMETNFKSDPYNQILNIQLTDKTVNLE
KLTEVTWIDGGPVLPTPTETSTIPMSSHPSPSTTNATSSETITSSASANTTTGTTATVPI
TTTSFPSTTNVTTNTTVTDTTSPFPTSTTNASTNATVPITTTRFATSTIGVTTNATVPDT
TAPFPTNTTTASTNATIPITTTPFATSTIGVTTSTTIPDTTAPFPTSTTSASTNATPVPI
TTTLFATSTIGVTTGTTVPDTTAPFPTSTTSASTNATPVPITATLFATSTIGVTTGTTVP
DTTAPFPTSTTGASTSATVPITTTSSLTNTADANTSNSVPNTTMPSPTSSTTVRTIATVP
MSVTPSLTSTADATISTTVLIATTSSLTGTTDVSTSTTINNISTPVQTNTTNASTSTNVA
NITATSHTSTDDTVPNNTVPITAIPSLANTGVDTTSNSFSIMTTSLSESTNAMNTAVIMA
TTSPTSTDVASTNNDASMTNFLLATMSAGNTTSNSISITTTSFGNSVPIVTAPSPNTGAT
TTSNNTIPGMTTYYQTSPTIPTHTLTSIPSSSTPILSMFPTSNTFTTDKITNFTTPTNAN
TIIFNTLDTKSTMIIDATVTTTSTKDNTMSPDTTVTSIDKFTTHITQFTTPHSATSATLA
LSHTSLAPTNLSDLGTIDITDADNSSSVTGNTTHFSVSNVTTASDTITATGLDSQTLHMV
TNSAATYLPITATSATTDTTNITKYALNTTTPDSTVHTSATAPAYITNAINTTQVP
NT seq 7551 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggaagctcagtgtattggaagtccttctgatcatcttctgcttaattgtggtg
accatagatatcctcttgctgcttcttgtgttggaggaaacttcagatacttcatttact
ccagagtgcccagagattccccaatcggaaaggatagactgcacacctgaccaggaggtg
accgaggatatctgcagatggcaatataagtgctgctggtcacctgtggtggatgccaat
gtccctaggtgcttcttcccctggaactggggctatgaagccagcaatggccatacaaat
acaagcacaggatttactgcccagttgaaaaggttgccatcaccatctctgtttggaaat
gatgttgccaccacccttttcacagctgaatatcagacatccaatcggtttcattttaag
atcactgactttaataacatacgctatgaagtttcccatgaaaatattaacctggttgat
gggactgctgatgcctccaatttgagctattacgtggaggttactgataaacctttcagc
atcaaaataatgaggacaagcaacagaagagtcctgttggacacgagcatcgggcccctc
cagtatgcccagcagtacctgcaactgtctttccgactgcccagtgccaatgtgtatggg
ctgggagagcatgtgcaccagcagtaccgccacaatatgacctggaagacctggcccatc
ttcacccgggatgctacccccaccgagggcatgattaatctgtatggagctcataccttc
ttcttgtgccttgaagatgccagtggctcctcttttggagtttttctgatgaacagtaat
gccatggaggttacccttcagccagctcctgcaatcacttatcgcacaattggaggcatt
cttgacttttatgtattcctaggaaacactccagaacaagtggttcaggaatacttggag
cttgttggacggccattcttgcctccctattggagtcttgggttccagcttagtcgcagg
gattatggtggcatcaataaattgaaagaagttgtaagccgaaatcgtttagctgagata
ccatatgatgtccagtactctgacatagactacatggatggaaagaaggatttcactgtt
gatgaagtcgcttactctggtctcccagattttgtcaaggagttacatgacaatgggcag
aaatatcttattattatgaatcctggcatctccaaaaactctaactatgagccctataat
aatggaagcctaaagagagtgtggatcttggggaacaatggctttgctgttggggaggga
tatccgggaccgacagtctttcccgattataccaacccagtatgcactgagtggtggaca
gatcaggttgctaaatttcatgatcatctggagtttgatggagtgtggattgaaatgaat
gaagtgtctagcttactccaagcttctgataaccagtgtgaatccaacaacttgaacttt
cctccttttcttcctagagttctggatcacttactttttgcaagaactctctgcatggac
acggagtttcatgggggccttcactatgacatccacagcttgtatggccactccatggca
agaaccacaaacttagccctggagaccatcttcatgaataataggagcttcatcttatcc
cgttctacttttgctggatctggcaaatttgctgctcattggctgggggacaatgcagcc
acatgggatgacctccgatggtctatccccactatccttgagttcaacctgtttggcatc
cccatggtaggtgccaacatctgtggttataacaacaatgtcacagaggagctctgcaga
aggtggatgcagcttggagcattttatccactaccaaggaatcacaatgggcccgggttc
agggaccaggatcctgctgcctttggtgccgattccctgctgctgaattcctccagacat
tatctgaacatccgctacaccttgctgccctatctctatacccttttctaccgcgctcac
acccggggagagacggtagcaaggccccttgtacatgagttctaccaggactcagccacg
tgggatgtgcatgagcagttcttatggggacctggactcctcatcacgcctgttttatat
gaaggtgtggatgaagtgaaagcatacatacctgatgccacctggtatgactatgagaca
ggagtggccatcccatggaggaaacagttggtgaatatgcttctcccaggtgataagata
ggacttcatctgcgagggggctacatatttcccactcagaagccaaacacaaccacagaa
accagccggaggaattccctgggactcatcatcgctttggactataagagagaagcaaag
ggggagctgtactgggatgacggtgtatctaaagatgctgtgactgaaaagaagtatatt
ctatatgatttctctgttacctctaaccatctacaagcaaagattataaataataattat
atggacactgacaacctcatgtttacagatatgacaatcttgggaatggacaaacagcca
gctaattttatcgtcttagtgaataatgtcaccacctccagtccaagcattgtttacagt
gcttccacaaaggtggtaaccatcactgatctccaaggactggtactgggacaagaattc
tctattacgtggcatcttcctgtcagtgacctggagaagttcaactgctaccctgacaat
tcaacagcctctaaggagagttgtaggcagcgggggtgtctttgggaggacacatctact
cctggagtgcccacctgttactatgacaccatccctaattatgttgctagtgacattcag
tacctgaacaccagcatcactgcagacctttccctcctgatggcccctgagtcagctgct
gctgctgcctctgattctctctctgcaaagatcagcttcctccacctgaacgtgatctat
cacacagcaaccatgctgcaggtcaagatctatgaccccactaataaaagatatgaggtt
ccagtaccactaaacacccctccccaaccagttggtgaccctgaaaaccgtctgtatgat
gtcaggattcaaaacaatccttttggaatccagattcaacgcaaaaactccagcactgtg
atttgggattctcagctccctggcttcaccttcaatgacatgtttctctccatttctacg
cgtcttccgtctcagtacatctatggctttggggaaactgagcacacgactttcagaaga
aacatgaactggaacacatggggaatgttttctcgtgatgagccacctacgtacaagaag
aatgcctatggtgtccacccttactacatggcactggaggaggatggcagcgcccatgga
gtgctcctgctaaatagcaatgccatggatgtgacattacagcccactcctgccctgaca
taccgcaccacaggagggattttggacttctacattgttttggggccaacccctgaactt
gtaactcagcaatacacagagttgattggtcggccagcaatgattccatactgggccttg
ggattccagctgagtcgctatggataccagaatgatgctgaaatctccagtttgtatgat
gcaatggtggcagcccagattccctatgacgtccagcatgtagacatcgattacatgaac
cggaagctggatttcaccctcagtgccaactttcaaaacctcagtgttctgattgagcaa
atgaagaaaaatggcatgagatttattctcattttggacccagccatttctggcaatgag
acacagtatctcccattcattagaggacaggaaaataacgtgttcatcaaatggcctgac
accaatgacattgtctggggaaaggtttggccagatctgcctaatgtaattgtagatgga
tcccttgaccatgaaactcaggttaagctttacagggcctacgttgcctttcctgacttc
tttcgtaatagcacagctgcgtggtggaagaaagagatagaagagctctatgcaaaccct
cgagagccagagaagagcttgaagtttgatggattgtggattgatatgaatgagccatca
aattttgtggatggatctgtcaggggctgcagcgatgaaatgctaaataacccaccctat
atgccatatttggaatccagggacaagggcctgaacagcaagaccctgtgcatggagagt
cagcagatcctgccagacagctcctccgtgcagcactacaatgttcacagcctgtacggg
tggtcccagaccagacccacatacgaagctgtgcaggaggtgacaggacagcgaggggtc
gtcatcacccgctccacatttccctcttctggacgctggggaggacactggctgggagac
aacacagctgagtgggaccagctggggaaatctatcattggcatgatggatttcagtctc
tttggaataccttatacaggagcagatatctgtgggttctttggagatgctgaatatgag
atgtgtgttcgctggatgcaactgggggcattttatccattttccagaaaccacaacaac
atcgggacaaggagacaagatcctgtggcctggaattcaacctttgagatgttgtccaga
gaagtcctagagaccagatacaccctgcttccttatctctatactctgatgcataaagct
cacgttgagggcagcactgttgtccggccccttctccatgagtttacggatgacaggaca
acatgggatatagaccgtcagttcatgttgggccctgctatcttaatcagccctgtgttg
gaaactagcacatttgaggtctctgcttattttccaagagcccgttggtatgactatagc
acgggaactggcagcaaatcgacaggtcagaggaaaatcctgaaggctccccttgaccac
atcaaccttcatgtcagaggaggctacatcctgccctggcaagagcctgcaatgaacact
cactccagtcgacaaaattttatgggattgattattgctttggatgacaatgggacagct
gaaggccaggtgttctgggatgatggacaaagcattgatacctatgaaaatggaaattat
tttttggcaaactttatagcagctcagaacttcctgcaaatccagaccatacacaataag
tatttgagtgactcgaatccactaaaagttgggtatattagaatctggggtgtgaatacc
tatgtgacacaagtcagttacacctatgacaatcagcaatttatggagacaaatttcaag
agtgacccttataatcagatactaaatattcaattgactgacaagactgtcaacctggaa
aagttaactgaggttacttggattgatggtggtcctgtacttcctactccaactgagaca
agtaccatcccaatgagttctcatccttctccatctactaccaatgccaccagttctgag
acaatcaccagttctgccagtgcaaatactaccactggcactactgctactgttcctatc
acaaccacatctttcccaagtactactaatgttacaactaatactactgttactgataca
acttctcctttccctacaagtactactaatgctagcactaatgctactgttcctatcaca
accacacgttttgcaacaagtactattggtgttacaactaatgctactgttcccgataca
actgcccctttcccaacgaatactactactgctagcactaatgctactattcctatcaca
accacaccttttgcaacaagtactattggtgttacaactagtactactattcctgataca
actgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcctatc
acaaccacactttttgcaacaagtactattggtgttacaactggtactactgttcctgat
acaactgctcctttccctacaagtactactagtgctagcactaatgctacccctgttcct
atcacagccacactttttgcaacaagtactattggtgttacaactggtactactgttcct
gatacaactgctcctttccctacaagtactactggtgctagcactagtgctactgttcct
attacaaccacatcttcccttacaaatactgctgatgctaacactagtaatagtgttcct
aataccactatgccttctcctacaagtagtactactgtgcgtactattgctaccgttccc
atgtcagtgactccttctctgacaagtactgctgatgccaccattagcactactgtactt
attgccactacttcttctctaacaggtactactgatgttagcactagtactactattaat
aatataagtactcctgttcaaacaaatactactaatgctagtactagtactaatgttgct
aatataactgctacctctcatacaagtactgatgatactgttcctaataatactgttcca
attacagctattccttctcttgcaaatactggtgttgacactactagcaacagtttttcc
attatgaccacttctctctctgaaagtactaatgctatgaacactgctgttattatggca
actacttctcctacaagtactgatgttgctagcacaaataatgatgcttctatgacaaat
tttcttttagctacaatgtctgctggtaatacaactagtaatagtatttccataacaact
acttcttttggtaatagtgttcctattgtgactgctccttctccaaatactggtgctact
actacaagtaataatactattcctggcatgactacttattaccagacttctcctaccatt
cctacccatactcttacttctattcctagctctagtactcctattttgagcatgtttcca
acaagtaatacattcactactgataaaattactaattttactacccctacaaatgcaaac
accattattttcaacactcttgatacaaaaagtaccatgataatagatgctacggtcact
actaccagcaccaaagataataccatgagtccagatacaacagttacttccatagacaaa
ttcaccacacacatcacacagttcactactccccattctgctactagtgcaacactggcc
ttaagccacacctcattagctcctacaaatctttcggatctaggcaccatagatattact
gatgcagataactccagcagtgttacaggtaacactacacacttttctgtttcaaatgtc
acaacagcctcagacacaataacagctactggtctagattcacaaactctccatatggta
acaaattctgcggctacttatttacctattactgcaactagtgctaccacagatactaca
aatattacaaaatatgctttgaatactaccactcctgatagtacagtacatacttctgct
actgcacctgcttatattacaaatgccataaatactactcaagttccatga

DBGET integrated database retrieval system