KEGG   Pongo abelii (Sumatran orangutan): 100455867Help
Entry
100455867         CDS       T01416                                 

Gene name
MMP9
Definition
(RefSeq) LOW QUALITY PROTEIN: matrix metalloproteinase-9
  KO
K01403  matrix metalloproteinase-9 (gelatinase B) [EC:3.4.24.35]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01522  Endocrine resistance
pon04657  IL-17 signaling pathway
pon04668  TNF signaling pathway
pon04670  Leukocyte transendothelial migration
pon04915  Estrogen signaling pathway
pon04926  Relaxin signaling pathway
pon05161  Hepatitis B
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05215  Prostate cancer
pon05219  Bladder cancer
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100455867 (MMP9)
 09150 Organismal Systems
  09151 Immune system
   04657 IL-17 signaling pathway
    100455867 (MMP9)
   04670 Leukocyte transendothelial migration
    100455867 (MMP9)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    100455867 (MMP9)
   04926 Relaxin signaling pathway
    100455867 (MMP9)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100455867 (MMP9)
   05202 Transcriptional misregulation in cancer
    100455867 (MMP9)
   05206 MicroRNAs in cancer
    100455867 (MMP9)
   05205 Proteoglycans in cancer
    100455867 (MMP9)
  09162 Cancer: specific types
   05219 Bladder cancer
    100455867 (MMP9)
   05215 Prostate cancer
    100455867 (MMP9)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100455867 (MMP9)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100455867 (MMP9)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    100455867 (MMP9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100455867 (MMP9)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.35  gelatinase B
     100455867 (MMP9)
Peptidases and inhibitors [BR:pon01002]
 Metallo peptidases
  Family M10
   100455867 (MMP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M10 fn2 Hemopexin PG_binding_1 PT Reprolysin_4 Reprolysin_3 DUF4953
Motif
Other DBs
NCBI-GeneID: 100455867
NCBI-ProteinID: XP_002830421
Ensembl: ENSPPYG00000011084
UniProt: H2P256
LinkDB All DBs
Position
20
AA seq 707 aa AA seqDB search
MSLWQPLVLALLVLGCCFAAPRRHQSTLVLFPGDLRTNLTDRQLAEEYLYRYGYTRVAEM
RGESKSLGPALLLLQKQLSLPETGELDSATLKAMRTPRCGVPDLGRFQTFEGDLKWHHRD
ITYWIQNYSEDLPRAVIDDAFARAFALWSAVTPLNFTRVYSRDADIVIQFGVAEHGDGYP
FDGKDGLLAHAFPPGPGIQGDAHFDDDELWSLGKGVVVPTRFGNADGAACHFPFTFEGRS
YSACTTDGRSDGVPWCSTTANYDTDGRFGFCPSERLYTQDGNADGKPCQFPFIFQGQSYS
ACTTDGRSDGYRWCATTANYDQDKLFGFCPTRADSTVMGGNSAGELCVFPFTFLGKEYST
CTSEGRRDGRLWCATTSNFDSDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMY
PMYRFTEEPPLHKDDVNGIQHLYGPRPEPEPRPPTTTTPQPTAPPTVCPTGPPTVRPSER
PTAGPTGPPXAGPTGPPTAGPSTATTVPLSPVDDACNVDIFDAIAEIGNQLHLFKDGKYW
RFSEGRGSRPQGPFLIADKWPALPRKLDSVFEEPLSKKLFFFSGRQVWVYTGASVLGPRR
LDKLGLGADVAQVTGALRSGRGKMLLFSGRRLWRFDVKAQMVDPRSATEVDRMFPGVPLD
THDVFQYREKAYFCQDRFYWRVSSRSELNQVDQVGYVTYDILQCPED
NT seq 2124 nt NT seq  +upstreamnt  +downstreamnt
atgagcctctggcagcccctggtcctggcgctcctggtgctgggctgctgctttgctgcc
cccagacggcaccagtccacccttgtgctcttccctggagacctgagaaccaatctcaca
gacaggcagctggcagaggaatacctgtaccgctatggttacactcgggtggcagagatg
cgcggagagtcgaaatctctggggcctgcgctgctgcttctccagaagcaactgtccctg
cccgagacgggtgagctggacagcgccacgctgaaggccatgcgaaccccacggtgcggg
gtcccagacctgggcagattccaaacctttgagggcgacctcaagtggcaccaccgcgac
atcacttattggatccaaaactactcggaagacttgccgcgggcggtgattgacgacgcc
tttgcccgcgccttcgcgctgtggagcgcggtgacgccgctcaacttcactcgcgtgtac
agccgggacgcagacatcgtcatccagtttggtgtcgcggagcacggagacgggtatccc
ttcgacgggaaggacgggctcctggcacacgcctttcctcctggccccggcattcaggga
gacgcccatttcgatgatgacgagttgtggtccctgggcaagggcgtcgtggttccaact
cggtttggaaacgcagatggcgcggcctgccacttccccttcaccttcgagggccgttcg
tactctgcctgcaccaccgacggtcgctccgacggcgtgccctggtgcagtaccacggcc
aactacgacaccgacggccggtttggcttctgccccagcgagagactctacacccaggac
ggcaatgctgatgggaaaccctgccagtttccattcatcttccaaggccaatcctactcc
gcctgcaccacggacggtcgctccgacggctaccgctggtgcgccaccaccgccaactac
gaccaggacaagctcttcggcttctgcccgacccgagccgactcgacggtgatggggggc
aactcggcgggggagctgtgcgtcttccccttcactttcctgggtaaggagtactcgacc
tgtaccagcgagggccgcagagatgggcgcctctggtgcgctaccacctcgaactttgac
agcgacaagaagtggggcttctgcccggaccaaggatacagtttgttcctcgtggcggcg
catgagttcggccacgcgctgggcttagatcattcctcagtgccggaggcgctcatgtac
cctatgtaccgcttcactgaggagccccctttgcataaggacgacgtgaatggcatccag
cacctctatggtcctcgccctgaacctgagccacggcctccaaccaccaccacaccgcag
cccacggctcccccaacggtctgccccaccggaccccccactgtccgcccctcagagcgc
cccacagctggccccacaggtccccctncagctggccccacaggtccccccactgctggc
ccttctacggccactactgtgcctttgagtccggtggacgacgcctgcaacgtggacatc
ttcgacgccatcgcggagatcgggaaccagctgcatttgttcaaggatgggaagtactgg
cgattctctgagggcagggggagccggccgcagggccctttccttatcgccgacaagtgg
cccgcgctgccccgcaagctggactcggtatttgaggagccgctctccaagaagcttttc
ttcttctctgggcgccaggtgtgggtgtacacaggcgcgtcggtgctgggcccgaggcgt
ctggacaagctgggcctgggcgccgacgtggcccaggtgaccggggccctccggagtggc
agggggaagatgctgctgttcagcgggcggcgcctctggaggttcgacgtgaaggcgcag
atggtggatccccggagcgccaccgaggtggaccggatgttccccggggtgcctttggac
acgcacgacgtcttccagtaccgagagaaagcctatttctgccaggaccgcttctactgg
cgcgtgagttcccggagtgagttgaaccaggtggaccaagtgggctatgtgacctatgac
atcctgcagtgccctgaggactag

DBGET integrated database retrieval system