KEGG   Pongo abelii (Sumatran orangutan): 100456735
Entry
100456735         CDS       T01416                                 

Gene name
MYC
Definition
(RefSeq) myc proto-oncogene protein
  KO
K04377  Myc proto-oncogene protein
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04110  Cell cycle
pon04151  PI3K-Akt signaling pathway
pon04218  Cellular senescence
pon04310  Wnt signaling pathway
pon04350  TGF-beta signaling pathway
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04630  JAK-STAT signaling pathway
pon04919  Thyroid hormone signaling pathway
pon05132  Salmonella infection
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05163  Human cytomegalovirus infection
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05202  Transcriptional misregulation in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05213  Endometrial cancer
pon05216  Thyroid cancer
pon05219  Bladder cancer
pon05220  Chronic myeloid leukemia
pon05221  Acute myeloid leukemia
pon05222  Small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100456735 (MYC)
   04012 ErbB signaling pathway
    100456735 (MYC)
   04310 Wnt signaling pathway
    100456735 (MYC)
   04350 TGF-beta signaling pathway
    100456735 (MYC)
   04390 Hippo signaling pathway
    100456735 (MYC)
   04630 JAK-STAT signaling pathway
    100456735 (MYC)
   04151 PI3K-Akt signaling pathway
    100456735 (MYC)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100456735 (MYC)
   04218 Cellular senescence
    100456735 (MYC)
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100456735 (MYC)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    100456735 (MYC)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456735 (MYC)
   05202 Transcriptional misregulation in cancer
    100456735 (MYC)
   05206 MicroRNAs in cancer
    100456735 (MYC)
   05205 Proteoglycans in cancer
    100456735 (MYC)
   05230 Central carbon metabolism in cancer
    100456735 (MYC)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100456735 (MYC)
   05225 Hepatocellular carcinoma
    100456735 (MYC)
   05226 Gastric cancer
    100456735 (MYC)
   05216 Thyroid cancer
    100456735 (MYC)
   05221 Acute myeloid leukemia
    100456735 (MYC)
   05220 Chronic myeloid leukemia
    100456735 (MYC)
   05219 Bladder cancer
    100456735 (MYC)
   05213 Endometrial cancer
    100456735 (MYC)
   05224 Breast cancer
    100456735 (MYC)
   05222 Small cell lung cancer
    100456735 (MYC)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100456735 (MYC)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100456735 (MYC)
   05161 Hepatitis B
    100456735 (MYC)
   05160 Hepatitis C
    100456735 (MYC)
   05163 Human cytomegalovirus infection
    100456735 (MYC)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100456735 (MYC)
   05169 Epstein-Barr virus infection
    100456735 (MYC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100456735 (MYC)
   03019 Messenger RNA biogenesis [BR:pon03019]
    100456735 (MYC)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    100456735 (MYC)
Messenger RNA biogenesis [BR:pon03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     100456735 (MYC)
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH TRH
Other DBs
NCBI-GeneID: 100456735
NCBI-ProteinID: XP_009242363
LinkDB
Position
8
AA seq 439 aa
MPLNVSFTNRNYDLDYDSVQPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPP
LSPSRRSGLCSPSYVAVTPFSPRGDNDGGGGSFSTADQLEMVTELLGGDMVNQSFICDPD
DETFIKNIIIQDCMWSGFSAAAKLVSEKLASYQAARKDSGSPNPARGHSVSSTSSLYLQD
LSAAASECIDPSVVFPYPLNDSSLPKSCTSPDSSAFSPSSDSLLSSTESSPQASPEPLVL
HEETPPTTSSDSEEEQEDEEEIDVVSVEKRQAPGKRSESGSPSAGGHIKPPHSPLVLKRC
HVSTHQHNYAAPPSTRKDYPAAKRVKLDSVRVLRQISNNRKCTSPRSSDAEENDKRRTHN
VLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKATAYILSIQAEEQKLISEKDLL
RKRREQLKHKLEQLRNSCA
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgcccctcaacgttagcttcaccaacaggaactatgacctcgactacgactcggtgcag
ccgtatttctactgcgacgaggaggagaacttctaccagcagcagcagcagagcgagctg
cagcccccggcgcccagcgaggatatctggaagaaattcgagctgctgcccaccccgccc
ctgtcccctagccgccgctccgggctctgctcgccctcctacgttgcggtcacgcccttc
tcccctcggggagacaacgacggcggtggcgggagcttctccacggccgaccagctggag
atggtgaccgagctgctgggaggagacatggtgaaccagagtttcatctgcgacccggac
gacgagaccttcatcaaaaacatcatcatccaggactgtatgtggagcggcttctcggcc
gccgccaagctcgtctcagagaagctggcctcctaccaggctgcgcgcaaagacagcggc
agcccgaaccccgcccgcggccacagcgtcagctccacctctagcttgtacctgcaggat
ctgagcgccgccgcctcagagtgcatcgacccctcggtggtcttcccctaccctctcaac
gacagtagcttgcccaagtcctgcacctcgccagactccagcgccttctctccgtcctcg
gattctctgctctcctcgacggagtcctccccgcaggccagccccgagcccctggtgctc
catgaagagacaccgcccaccaccagcagcgactctgaggaggaacaagaagatgaggaa
gaaatcgatgttgtttctgtggaaaagaggcaggctcctggcaaaaggtcagagtctgga
tcaccttctgctggaggccacatcaaacctcctcacagcccactggtcctcaagaggtgc
cacgtctccacacatcagcacaactacgcagcgcctccctccactcggaaggactatcct
gctgccaagagggtcaagttggacagtgtcagagtcctgagacagatcagcaacaaccga
aaatgcaccagccccaggtcctcggacgccgaggagaatgacaagaggcgaacacacaac
gtcttggagcgccagaggaggaacgagctaaaacggagcttttttgccctgcgtgaccag
atcccggagttggaaaacaatgaaaaggcccccaaggtagttatccttaaaaaagccaca
gcatacatcctgtccatccaagcagaggagcaaaagctcatttctgaaaaggacttgttg
cggaaacgacgagaacagttgaaacacaaacttgaacagctacggaactcttgtgcataa

DBGET integrated database retrieval system