KEGG   Pongo abelii (Sumatran orangutan): 100456786
Entry
100456786         CDS       T01416                                 

Gene name
MTOR
Definition
(RefSeq) serine/threonine-protein kinase mTOR
  KO
K07203  serine/threonine-protein kinase mTOR [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04072  Phospholipase D signaling pathway
pon04136  Autophagy - other
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04218  Cellular senescence
pon04371  Apelin signaling pathway
pon04613  Neutrophil extracellular trap formation
pon04630  JAK-STAT signaling pathway
pon04659  Th17 cell differentiation
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04919  Thyroid hormone signaling pathway
pon04920  Adipocytokine signaling pathway
pon04930  Type II diabetes mellitus
pon04931  Insulin resistance
pon04935  Growth hormone synthesis, secretion and action
pon05010  Alzheimer disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05017  Spinocerebellar ataxia
pon05022  Pathways of neurodegeneration - multiple diseases
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100456786 (MTOR)
   04371 Apelin signaling pathway
    100456786 (MTOR)
   04630 JAK-STAT signaling pathway
    100456786 (MTOR)
   04066 HIF-1 signaling pathway
    100456786 (MTOR)
   04072 Phospholipase D signaling pathway
    100456786 (MTOR)
   04151 PI3K-Akt signaling pathway
    100456786 (MTOR)
   04152 AMPK signaling pathway
    100456786 (MTOR)
   04150 mTOR signaling pathway
    100456786 (MTOR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100456786 (MTOR)
   04136 Autophagy - other
    100456786 (MTOR)
  09143 Cell growth and death
   04218 Cellular senescence
    100456786 (MTOR)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    100456786 (MTOR)
   04659 Th17 cell differentiation
    100456786 (MTOR)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100456786 (MTOR)
   04920 Adipocytokine signaling pathway
    100456786 (MTOR)
   04935 Growth hormone synthesis, secretion and action
    100456786 (MTOR)
   04919 Thyroid hormone signaling pathway
    100456786 (MTOR)
  09149 Aging
   04211 Longevity regulating pathway
    100456786 (MTOR)
   04213 Longevity regulating pathway - multiple species
    100456786 (MTOR)
  09159 Environmental adaptation
   04714 Thermogenesis
    100456786 (MTOR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456786 (MTOR)
   05206 MicroRNAs in cancer
    100456786 (MTOR)
   05205 Proteoglycans in cancer
    100456786 (MTOR)
   05230 Central carbon metabolism in cancer
    100456786 (MTOR)
   05231 Choline metabolism in cancer
    100456786 (MTOR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100456786 (MTOR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100456786 (MTOR)
   05212 Pancreatic cancer
    100456786 (MTOR)
   05225 Hepatocellular carcinoma
    100456786 (MTOR)
   05226 Gastric cancer
    100456786 (MTOR)
   05214 Glioma
    100456786 (MTOR)
   05221 Acute myeloid leukemia
    100456786 (MTOR)
   05215 Prostate cancer
    100456786 (MTOR)
   05224 Breast cancer
    100456786 (MTOR)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100456786 (MTOR)
   05014 Amyotrophic lateral sclerosis
    100456786 (MTOR)
   05016 Huntington disease
    100456786 (MTOR)
   05017 Spinocerebellar ataxia
    100456786 (MTOR)
   05022 Pathways of neurodegeneration - multiple diseases
    100456786 (MTOR)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    100456786 (MTOR)
   04931 Insulin resistance
    100456786 (MTOR)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100456786 (MTOR)
   05168 Herpes simplex virus 1 infection
    100456786 (MTOR)
   05163 Human cytomegalovirus infection
    100456786 (MTOR)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100456786 (MTOR)
   05165 Human papillomavirus infection
    100456786 (MTOR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100456786 (MTOR)
   01522 Endocrine resistance
    100456786 (MTOR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100456786 (MTOR)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100456786 (MTOR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100456786 (MTOR)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100456786 (MTOR)
Membrane trafficking [BR:pon04131]
 Autophagy
  Other autophagy associated proteins
   mTORC1 complex
    100456786 (MTOR)
SSDB
Motif
Pfam: FAT PI3_PI4_kinase DUF3385 FRB_dom FATC HEAT_2 UME V-ATPase_H_N EPSP_synthase HEAT_EZ Nipped-B_C
Other DBs
NCBI-GeneID: 100456786
NCBI-ProteinID: XP_024108864
LinkDB
Position
1
AA seq 2549 aa
MLGTGPAAATTAATTSSNVSVLQQFASGLKSRNEETRAKAAKELQHYVTMELREMSQEES
TRFYDQLNHHIFELVSSSDANERKGGILAIASLIGVEGGNATRIGRFANYLRNLLPSNDP
VVMEMASKAIGRLAMAGDTFTAEYVEFEVKRALEWLGADRNEGRRHAAVLVLRELAISVP
TFFFQQVQPFFDNIFVAVWDPKQAIREGAVAALRACLILTTQREPKEMQKPQWYRHTFEE
AEKGFDETLAKEKGMNRDDRIHGALLILNELVRISSMEGERLREEMEEITQQQLVHDKYC
KDLMGFGTKPRHITPFTSFQAVQPQQSNALVGLLGYSSHQGLMGFGVSPSPAKSTLVESR
CCRDLMEEKFDQVCQWVLKCRNSKNSLIQMTILNLLPRLAAFRPSAFTDTQYLQDTMNHV
LSCVKKEKERTAAFQALGLLSVAVRSEFKVYLPRVLDIIRAALPPKDFAHKRQKAMQVDA
TVFTCISMLARAMGPGIQQDIKELLEPMLAVGLSPALTAVLYDLSRQIPQLKKDIQDGLL
KMLSLVLMHKPLRHPGMPKGLAHQLASPGLTTLPEASDVGSITLALRTLGSFEFEGHSLT
QFVRHCADHFLNSEHKEIRMEAARTCSRLLTPSIHLISGHAHVVSQTAVQVVADVLSKLL
VVGITDPDPDIRYCVLASLDERFDAHLAQAENLQALFVALNDQVFEIRELAICTVGRLSS
MNPAFVMPFLRKMLIQILTELEHSGIGRIKEQSARMLGHLVSNAPRLIRPYMEPILKALI
LKLKDPDPDPNPGVINNVLATIGELAQVSGLEMRKWVDELFIIIMDMLQDSSLLAKRQVA
LWTLGQLVASTGYVVEPYRKYPTLLEVLLNFLKTEQNQGTRREAIRVLGLLGALDPYKHK
VNIGMIDQSRDASAVSLSESKSSQDSSDYSTSEMLVNMGNLPLDEFYPAVSMVALMRIFR
DQSLSHHHTMVVQAITFIFKSLGLKCVQFLPQVMPTFLNVIRVCDGAIREFLFQQLGMLV
SFVKSHIRPYMDEIVTLMREFWVMNTSIQSTIILLIEQIVVALGGEFKLYLPQLIPHMLR
VFMHDNSPGRIVSIKLLAAIQLFGANLDDYLHLLLPPIVKLFDAPEAPLPSRKAALETVD
RLTESLDFTDYASRIIHPIVRTLDQSPELRSTAMDTLSSLVFQLGKKYQIFIPMVNKVLV
RHRINHQRYDVLICRIVKGYTLADEEEDPLIYQHRMLRSGQGDALASGPVETGPMKKLHV
STINLQKAWGAARRVSKDDWLEWLRRLSLELLKDSSSPSLRSCWALAQAYNPMARDLFNA
AFVSCWSELNEDQQDELIRSIELALTSQDIAEVTQTLLNLAEFMEHSDKGPLPLRDDNGI
VLLGERAAKCRAYAKALHYKELEFQKGPTPAILESLISINNKLQQPEAAAGVLEYAMKHF
GELEIQATWYEKLHEWEDALVAYDKKMDTNKDDPELMLGRMRCLEALGEWGQLHQQCCEK
WTLVNDETQAKMARMAAAAAWGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLA
QQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
ERLQGCQRIVEDWQKILMVRSLVVSPHEDMRTWLKYASLCGKSGRLALAHKTLVLLLGVD
PSRQLDHPLPTVHPQVTYAYMKNMWKSARKIDAFQHMQHFVQTMQQQAQHAIATEDQQHK
QELHKLMARCFLKLGEWQLNLQGINESTIPKVLQYYSAATEHDRSWYKAWHAWAVMNFEA
VLHYKHQNQARDEKKKLRHASGANITNATTAATTAATATTTASTEGSNSESEAESTENSP
TPSPLQKKVTEDLSKTLLMYTVPAVQGFFRSISLSRGNNLQDTLRVLTLWFDYGHWPDVN
EALVEGVKAIQIDTWLQVIPQLIARIDTPRPLVGRLIHQLLTDIGRYHPQALIYPLTVAS
KSTTTARHNAANKILKNMCEHSNTLVQQAMMVSEELIRVAILWHEMWHEGLEEASRLYFG
ERNVKGMFEVLEPLHAMMERGPQTLKETSFNQAYGRDLMEAQEWCRKYMKSGNVKDLTQA
WDLYYHVFRRISKQLPQLTSLELQYVSPKLLMCRDLELAVPGTYDPNQPIIRIQSIAPSL
QVITSKQRPRKLTLMGSNGHEFVFLLKGHEDLRQDERVMQLFGLVNTLLANDPTSLRKNL
SIQRYAVIPLSTNSGLIGWVPHCDTLHALIRDYREKKKILLNIEHRIMLRMAPDYDHLTL
MQKVEVFEHAVNNTAGDDLAKLLWLKSPSSEVWFDRRTNYTRSLAVMSMVGYILGLGDRH
PSNLMLDRLSGKILHIDFGDCFEVAMTREKFPEKIPFRLTRMLTNAMEVTGLDGNYRITC
HTVMEVLREHKDSVMAVLEAFVYDPLLNWRLMDTNTKGNKRSRTRTDSYSAGQSVEILDG
VELGEPAHKKTGTTVPESIHSFIGDGLVKPEALNKKAIQIINRVRDKLTGRDFSHDDTLD
VPTQVELLIKQATSHENLCQCYIGWCPFW
NT seq 7650 nt   +upstreamnt  +downstreamnt
atgcttggaactggacctgccgccgccaccaccgctgccaccacatctagcaatgtgagc
gtcctgcagcagtttgccagtggcctaaagagccggaatgaggagaccagggccaaagcc
gccaaggagctccagcactatgtcaccatggaactccgagagatgagtcaagaggagtct
actcgcttctatgaccaactgaaccatcacatttttgaattggtttccagctcagatgcc
aatgagaggaaaggtggcatcttggccatagctagcctcataggagtggaaggtgggaat
gccacccgaattggcagatttgccaactatcttcggaacctcctcccctccaatgaccca
gttgtcatggaaatggcatccaaggccattggccgtcttgccatggcaggggacactttt
actgctgagtacgtggaatttgaggtgaagcgagccctggaatggctgggtgctgaccgc
aatgagggccggagacatgcagctgtcctggttctccgtgagctggccatcagcgtccct
accttcttcttccagcaagtgcagcccttctttgacaacatttttgtggccgtgtgggac
cccaaacaggctatccgtgagggagctgtagccgcccttcgtgcctgtctgattctcacc
acccagcgtgagccgaaggagatgcagaagcctcagtggtacaggcacacatttgaagaa
gcagagaagggatttgatgagaccttggccaaagagaagggcatgaatcgggatgatcgg
atccatggagccttgctgatccttaacgagctggtccgaatcagcagcatggagggagag
cgtctgagagaagaaatggaagaaatcacacagcagcagctggtacacgacaagtactgc
aaagatctcatgggcttcggaacaaaacctcgtcacattacccccttcaccagtttccag
gctgtacagccccagcagtcaaatgccttggtggggctgctggggtacagctctcaccaa
ggcctcatgggatttggggtctcccccagtccagctaagtccaccctggtggagagccgg
tgttgcagagacttgatggaggagaaatttgatcaggtgtgccagtgggtgctgaaatgc
aggaatagcaagaactcgctgatccaaatgacaatccttaatttgttgccccgcttggct
gcattccgaccttctgccttcacagatacccagtacctccaagataccatgaaccatgtc
ctaagctgtgtcaagaaggagaaggaacgtacagcagccttccaagccctggggctactt
tccgtggctgtgaggtctgaatttaaggtctatttgcctcgcgtgctggacatcatccga
gcggccctgcccccaaaggacttcgcccataagaggcagaaggcaatgcaggtggacgcc
acagtcttcacttgcatcagcatgctggctcgagcaatggggccaggcatccagcaggat
atcaaggagctactggagcccatgctggcagtggggctaagccctgccctcactgcagtg
ctctacgacctgagccgtcagattccacagctaaagaaggacattcaagatgggctactg
aaaatgctgtccctggtccttatgcacaaacccctccgccacccaggcatgcccaagggc
ctggcccatcagctggcctctcctggcctcacgaccctccctgaggccagcgatgtgggc
agcatcactcttgccctccgaacgcttggcagctttgaatttgaaggccactctctgacc
caatttgttcgccactgtgcggatcatttcctgaacagtgagcacaaggagatccgcatg
gaggctgcccgcacctgctcccgcctgctcacaccctccatccacctcatcagtggccat
gctcatgtggttagccagaccgcagtgcaagtggtggcagatgtgcttagcaaactgctc
gtggttgggataacagatcctgaccctgacattcgctattgtgtcttggcgtccctggac
gagcgctttgatgcacacctggcccaggcggagaacttgcaggccttgtttgtggctctg
aatgaccaggtgtttgagatccgggagctggccatctgcactgtgggccgactcagtagc
atgaaccctgcctttgtcatgcctttcctgcgcaagatgctcatccagattttgacagag
ttggagcacagtgggattggaagaatcaaagagcagagtgcccgcatgctggggcacctg
gtctccaatgccccccgactcatccgcccctacatggagcctattctgaaggcattaatt
ttgaaactgaaagatccagaccctgatccaaacccaggtgtgatcaataatgtcctggca
acaataggagaattggcacaggttagtggcctggaaatgaggaaatgggttgatgaactt
tttattatcatcatggacatgctccaggattcctctttgttggccaaaagacaggtggct
ctgtggaccctgggacagttggtggccagcactggctatgtagtagagccctacaggaag
taccctactttgcttgaagtgctactgaattttctgaagactgagcagaaccagggtaca
cgcagagaggccatccgtgtgttagggcttttaggggctttggatccttacaagcacaaa
gtgaacattggcatgatagaccagtcccgggatgcctctgctgtcagcctgtcagaatcc
aagtcaagtcaggattcctctgactatagcactagtgaaatgctggtcaacatgggaaac
ttgcctctggatgagttctacccagctgtgtccatggtggccctgatgcggatcttccga
gaccagtcactctctcatcatcacaccatggttgtccaggccatcaccttcatcttcaag
tccctgggactcaaatgtgtgcagttcctgccccaggtcatgcccacgttccttaatgtc
attcgagtctgtgatggggccatccgggaatttttgttccagcagctgggaatgttggtg
tcctttgtgaagagccacatcagaccttatatggatgaaatagtcaccctcatgagagaa
ttctgggtcatgaacacctcaattcagagcacgatcattcttctcattgagcaaattgtg
gtagctcttgggggtgaatttaagctctacctgccccagctgatcccacacatgctgcgt
gtcttcatgcatgacaacagcccaggccgcattgtctctatcaagttactggctgcaatc
cagctgtttggcgccaacctggatgactacctgcatttactgctgcctcctattgttaag
ttgtttgatgcccctgaagctccactgccatctcgaaaggcagcgctagagactgtggac
cgcctgacggagtccctggatttcactgactatgcctcccggatcattcaccctattgtt
cgaacactggaccagagcccagaactgcgctccacagccatggacacgctgtcttcactt
gtttttcagctggggaagaagtaccaaattttcattccaatggtgaataaagttcttgtg
cgacaccgaatcaatcatcagcgctacgatgtgctcatctgcagaattgtcaagggatac
acacttgctgatgaagaggaggatcctttgatttaccagcatcggatgcttaggagtggc
caaggggatgcattggctagtggacccgtggaaacaggacccatgaaaaaactgcacgtc
agcaccatcaacctccaaaaggcctggggcgctgccaggagggtctccaaagatgactgg
ctggaatggctgagacgactgagcctggagctgctgaaggactcatcatcgccctccctg
cgctcctgctgggccctggcacaggcctacaacccgatggccagggatcttttcaatgct
gcatttgtgtcctgctggtctgaactgaatgaagatcaacaggatgagctcatcagaagc
atcgagttggccctcacctcacaagacatcgctgaagtcacacagaccctcttaaacttg
gctgaattcatggaacacagtgacaagggccccctgccactgagagatgacaatggcatt
gttctgctgggtgagagagctgccaagtgccgagcatatgccaaagcactacactacaaa
gaactggagttccagaaaggccccacccctgccattctagaatctctcatcagcattaat
aataagctacagcagccggaggcagcggccggagtgttagaatatgccatgaaacacttt
ggagagctggagatccaggctacctggtatgagaaactgcatgagtgggaggatgccctt
gtggcctatgacaagaaaatggacacgaacaaggatgacccagagctgatgctcggccgc
atgcgctgcctcgaggccctgggggaatggggtcaactccaccagcagtgctgtgaaaag
tggaccctggttaatgatgagacccaagccaagatggcccggatggctgctgcagctgca
tggggtttaggtcagtgggacagcatggaagaatacacctgtatgatccctcgggacacc
catgatggggcattttatagagctgtgctggcactgcatcaggacctcttctccttggca
caacagtgcattgacaaggccagggacctgctggatgctgaattaactgcgatggcagga
gagagttacagtcgggcatatggggccatggtttcttgccacatgctgtccgagctggag
gaggttatccagtacaaacttgtccccgagcgacgagagatcatccgccagatctggtgg
gagagactgcagggctgccagcgtatcgtagaggactggcagaaaatccttatggtgcgg
tcccttgtggtcagccctcacgaagacatgagaacctggctcaagtatgcaagcctgtgc
ggcaagagtggcaggctggctcttgctcataaaaccttagtgttgctcctgggagttgat
ccatctcggcaacttgaccatcctctgccaacagttcaccctcaggtgacctatgcctac
atgaaaaacatgtggaagagtgcccgcaagatcgatgccttccagcacatgcagcatttt
gtccagaccatgcagcaacaggcccagcatgccatcgctactgaggaccagcagcataag
caggaactgcacaagctcatggcccgatgcttcttgaaacttggagagtggcagctgaat
ctacagggcatcaatgagagcacaatccccaaagtgctgcagtactacagcgccgccaca
gagcacgaccgcagctggtacaaggcctggcatgcgtgggcagtgatgaacttcgaagct
gtgctacattacaaacatcagaaccaagcccgcgacgagaagaagaaactgcgtcatgcc
agcggggccaacatcaccaatgccaccactgccgctaccacagccgccactgccaccacc
accgccagcaccgagggcagcaacagtgagagcgaggccgagagcaccgaaaacagcccc
accccatcaccgctgcagaagaaggtcactgaggatctgtccaaaaccctcctgatgtat
acggtgcctgctgtccagggcttcttccgttccatctccttgtcacgaggcaacaacctc
caggatacactcagagttctcaccttatggtttgattatggtcactggccagatgtcaac
gaggccttagtggagggggtgaaagccatccagattgatacctggctacaggttatacct
cagctcattgcaagaattgatacgcccagacccttggtgggacgtctcattcaccagctt
ctcacagacattggtcggtaccacccccaggccctcatctaccccctgacagtggcttct
aagtctaccacgacagcccggcacaatgcagccaacaagattctgaagaacatgtgtgag
cacagcaacaccctggtccagcaggccatgatggtgagcgaggagctgatccgagtggcc
atcctctggcatgagatgtggcacgaaggcctggaggaggcgtctcgtttgtactttggg
gaaaggaacgtgaaaggcatgtttgaggtgctggagcccttgcatgctatgatggaacgg
ggtccccagactctgaaggaaacatcctttaatcaggcctatggtcgagatttaatggag
gcccaagagtggtgcaggaagtacatgaaatcagggaatgtcaaggacctcacccaagcc
tgggacctctattatcatgtgttccgacgaatctcaaagcagctgcctcagctcacatcc
ttagagctgcaatatgtttccccaaaacttctgatgtgccgggaccttgaattggctgtg
ccaggaacatatgaccccaaccagccaatcattcgcattcagtccatagcaccgtctttg
caagtcatcacatctaagcagaggccccggaaattgacacttatgggcagcaacgggcat
gagtttgttttccttctaaaaggccatgaagatctgcgccaggatgagcgtgtgatgcag
ctcttcggcctggttaatacccttctggccaatgacccaacatctcttcggaaaaatctc
agcatccagagatatgctgtcatccctttatcgaccaactcgggcctcattggctgggtc
ccccactgtgacacactgcacgccctcatccgggactacagggagaagaagaagatcctt
ctcaacatagagcatcgcatcatgttgcggatggctccggactatgaccacttaactctg
atgcagaaggtggaggtgtttgagcatgccgtcaataatacagctggggacgacctggcc
aagctgctgtggctgaaaagccccagctctgaggtgtggtttgaccgaagaaccaattat
acccgttctttagcggtcatgtcaatggttgggtatattttaggcctgggagatagacac
ccatccaacctgatgctggaccgtctgagtgggaagatcctgcacattgactttggggac
tgctttgaggttgctatgacccgagagaagtttccagagaagattccatttagactaaca
agaatgttgaccaatgctatggaggttacaggcctggatggcaactacagaatcacatgc
cacacagtgatggaggtgctgcgagagcacaaggacagtgtcatggccgtgctggaagcc
tttgtctatgaccccttgctgaactggaggctgatggacacaaataccaaaggcaacaag
cgatccagaacgaggacggattcctactctgctggccagtcagtcgaaattttggacggt
gtggaacttggagagccagcccataagaaaacggggaccacagtgccagaatctattcat
tctttcattggagatggtttggtgaaaccagaggccctaaataagaaagctatccagatt
attaacagggttcgagataagctcactggtcgggacttctctcatgatgacactttggat
gttccaacgcaagttgagctgctcatcaaacaagcgacatcccatgaaaacctctgccag
tgctatattggctggtgccctttctggtaa

DBGET integrated database retrieval system