KEGG   Pongo abelii (Sumatran orangutan): 100456988
Entry
100456988         CDS       T01416                                 

Gene name
RPS6KB1
Definition
(RefSeq) LOW QUALITY PROTEIN: ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04350  TGF-beta signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04931  Insulin resistance
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100456988 (RPS6KB1)
   04350 TGF-beta signaling pathway
    100456988 (RPS6KB1)
   04371 Apelin signaling pathway
    100456988 (RPS6KB1)
   04066 HIF-1 signaling pathway
    100456988 (RPS6KB1)
   04151 PI3K-Akt signaling pathway
    100456988 (RPS6KB1)
   04152 AMPK signaling pathway
    100456988 (RPS6KB1)
   04150 mTOR signaling pathway
    100456988 (RPS6KB1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100456988 (RPS6KB1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100456988 (RPS6KB1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100456988 (RPS6KB1)
  09149 Aging
   04211 Longevity regulating pathway
    100456988 (RPS6KB1)
   04213 Longevity regulating pathway - multiple species
    100456988 (RPS6KB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    100456988 (RPS6KB1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100456988 (RPS6KB1)
   05205 Proteoglycans in cancer
    100456988 (RPS6KB1)
   05231 Choline metabolism in cancer
    100456988 (RPS6KB1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100456988 (RPS6KB1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100456988 (RPS6KB1)
   05212 Pancreatic cancer
    100456988 (RPS6KB1)
   05225 Hepatocellular carcinoma
    100456988 (RPS6KB1)
   05226 Gastric cancer
    100456988 (RPS6KB1)
   05221 Acute myeloid leukemia
    100456988 (RPS6KB1)
   05224 Breast cancer
    100456988 (RPS6KB1)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100456988 (RPS6KB1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100456988 (RPS6KB1)
   05163 Human cytomegalovirus infection
    100456988 (RPS6KB1)
   05165 Human papillomavirus infection
    100456988 (RPS6KB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100456988 (RPS6KB1)
   01522 Endocrine resistance
    100456988 (RPS6KB1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100456988 (RPS6KB1)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100456988 (RPS6KB1)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100456988 (RPS6KB1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal
Other DBs
NCBI-GeneID: 100456988
NCBI-ProteinID: XP_024091181
LinkDB
Position
17
AA seq 525 aa
MRRRRRRDGFYPAPDFRDKEAEDMAGVFDIDLDQPEDAGSEDELEEGGQLNESMDHGGVG
PYELGMEHCEKFEISETSVNRGPEKIRPECFELLRVLGKGGYGKVFQVRKVTGANTGKIF
AMKVLKKAMIVRNAKDTAHTKAERNILEEVKHPFIVDLIYAFQTGGKLYLILEYLSGGEL
FMQLEREGIFMEDTACFYLAEISMALGHLRQKGIIYRDLKPENIMLNHQGHVKLTDFGLR
KESIHDGTVTHTFCGTIKYMAPEILMRSGHNRAVDWWSLGAFMYDMLTGAPPFTGENRKK
TIDNILKCKLNLPPYLTQEARGLLKKLLKRNAASHLXDGPGDAGEMQAHPFFRHINWEKL
LAQKVEPPFKPVLQSEEDVSQFDSKFTRQTPVDSPDDAALSESANQVFLGFTYVAPSVLE
SVKEKFSFEPKIRSPRRFIGSPRTPVSPVKFSPGDFWGRGASASTANPQTPVEYPMETSG
IEQMDVTMSGEASAPLPIRQPNSGPYKKQAFPMISKRPEHLRMNL
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgaggcgacggaggaggcgggacggcttttacccagcgccggacttccgagacaaggaa
gctgaggacatggcaggagtgtttgacatagacctggaccagccagaggacgcgggctct
gaggatgagctggaggaggggggtcagttaaatgaaagcatggaccatgggggagttgga
ccatatgaacttggcatggaacattgtgagaaatttgaaatctcagaaactagtgtgaac
agagggccagaaaaaatcagaccagaatgttttgagctacttcgggtacttggtaaaggg
ggctatggaaaggtttttcaagtacgaaaagtaacaggagcaaatactgggaaaatattt
gccatgaaggtgcttaaaaaggcaatgatagtaagaaatgctaaagatacagctcataca
aaagcagaacggaatattctggaggaagtaaagcatcccttcatcgtggatttaatttat
gcctttcagactggtggaaaactctacctcatccttgagtatctcagtggaggagaacta
tttatgcagttagaaagagagggaatatttatggaagacactgcctgcttttacttggca
gaaatctccatggctttggggcatttacgtcaaaaggggatcatctacagagacctgaag
ccggagaatatcatgcttaatcaccaaggtcatgtgaaactaacagactttggactacgc
aaagaatctattcatgatggaacagtcacacacacgttttgtggaacaataaaatacatg
gcccctgaaatcttgatgagaagtggccacaatcgtgctgtggattggtggagtttggga
gcattcatgtatgacatgctgactggagcacccccatttactggggagaatagaaagaaa
acaattgacaacatcctcaaatgtaaactcaatttgcctccctacctcacacaagaagcc
agaggtctgcttaaaaagctgctgaaaagaaatgctgcttctcatctgtgagatggtcct
ggggacgctggagaaatgcaagctcatccattctttagacacattaactgggaaaaactt
ctggctcaaaaggtggagcccccttttaaacctgtgttgcaatctgaagaggatgtaagt
cagtttgattccaagtttacacgtcagacacctgtcgacagcccagatgacgcagctctc
agtgaaagtgccaatcaggtctttctgggttttacatatgtggctccatctgtacttgaa
agtgtgaaagaaaagttttcctttgaaccaaaaatccgatcacctcgaagatttattggc
agcccacgaacacctgtcagcccagtcaaattttctcctggggatttctggggaagaggt
gcttcggccagcacagcaaatcctcagacacctgtggaatacccaatggaaacaagtggc
atagagcagatggatgtcacaatgagtggggaagcatcggcaccacttccaatacgacag
ccgaactctgggccatacaaaaaacaagcttttcccatgatctccaaacggccagagcac
ctgcgtatgaatctatga

KEGG   Pongo abelii (Sumatran orangutan): 100459428
Entry
100459428         CDS       T01416                                 

Gene name
RPS6KB2
Definition
(RefSeq) ribosomal protein S6 kinase beta-2
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04350  TGF-beta signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04931  Insulin resistance
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100459428 (RPS6KB2)
   04350 TGF-beta signaling pathway
    100459428 (RPS6KB2)
   04371 Apelin signaling pathway
    100459428 (RPS6KB2)
   04066 HIF-1 signaling pathway
    100459428 (RPS6KB2)
   04151 PI3K-Akt signaling pathway
    100459428 (RPS6KB2)
   04152 AMPK signaling pathway
    100459428 (RPS6KB2)
   04150 mTOR signaling pathway
    100459428 (RPS6KB2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100459428 (RPS6KB2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100459428 (RPS6KB2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    100459428 (RPS6KB2)
  09149 Aging
   04211 Longevity regulating pathway
    100459428 (RPS6KB2)
   04213 Longevity regulating pathway - multiple species
    100459428 (RPS6KB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    100459428 (RPS6KB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459428 (RPS6KB2)
   05205 Proteoglycans in cancer
    100459428 (RPS6KB2)
   05231 Choline metabolism in cancer
    100459428 (RPS6KB2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459428 (RPS6KB2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459428 (RPS6KB2)
   05212 Pancreatic cancer
    100459428 (RPS6KB2)
   05225 Hepatocellular carcinoma
    100459428 (RPS6KB2)
   05226 Gastric cancer
    100459428 (RPS6KB2)
   05221 Acute myeloid leukemia
    100459428 (RPS6KB2)
   05224 Breast cancer
    100459428 (RPS6KB2)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100459428 (RPS6KB2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100459428 (RPS6KB2)
   05163 Human cytomegalovirus infection
    100459428 (RPS6KB2)
   05165 Human papillomavirus infection
    100459428 (RPS6KB2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459428 (RPS6KB2)
   01522 Endocrine resistance
    100459428 (RPS6KB2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459428 (RPS6KB2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100459428 (RPS6KB2)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100459428 (RPS6KB2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 100459428
NCBI-ProteinID: XP_002821492
Ensembl: ENSPPYG00000002993
LinkDB
Position
11
AA seq 508 aa
MMFRSGTVSQCAARYGPGVRGAGAAMAAVFDLDLETEEGSEGEGEPELSPADVCPVAESR
AAGLEPVGHYEEVELTETSVNLGPERIGPHCFELLRVLGKGGYGKVFQVRKVQGTNLGKI
YAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQTGGKLYLILECLSGGE
LFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKLTDFGL
CKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRK
KTMDKILKGKLALPAYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDD
LLAWRVDPPFRPCLQSEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVL
DSKEGFSFQPKLRSPRRLNSSPRAPISPLKFSPFEGFRPSPSLSEPTEPPLPPLLPPPPP
PPSTTAPLPIRPPSGTKKSKKGRGRPGR
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgatgtttaggtccgggactgtcagtcagtgcgcggccaggtacgggcccggggtccgc
ggggccggtgccgccatggcggccgtgtttgatttggatttggagacggaggaaggcagc
gagggcgagggcgagccagagctcagccccgcggacgtgtgtcccgttgccgagtcgagg
gcagctggcctagagcctgtgggacactatgaagaggtggagctgactgagaccagcgtg
aaccttggcccagagcgcatcgggccccactgctttgagctgctgcgtgtgctgggcaag
gggggctatggcaaggtgttccaggtgcgaaaggtgcaaggcaccaacttgggcaaaata
tatgccatgaaagtcctaaggaaggccaaaattgtgcgcaacgccaaggacacagcacac
acacgggctgagcggaacattctagagtcagtgaagcacccctttattgtggaactggcc
tatgccttccagactggtggcaaactctacctcatccttgagtgcctcagtggtggcgag
ctcttcacgcatctggagcgagagggcatcttcctggaagacacggcctgcttctacctg
gccgagatcacgctggccctgggccatctccactcccagggcatcatctaccgggacctc
aagcccgagaacatcatgctcagcagccagggccacatcaaactgaccgactttggactc
tgcaaggagtcgatacatgagggcgccgtcacccacaccttctgcggcaccattgagtac
atggcccctgagattctggtgcgcagtggccacaaccgggctgtggactggtggagcctg
ggggccctgatgtacgacatgctcactggatcgcctcccttcactgcagagaaccggaag
aaaaccatggataagatcctaaagggcaagctggcgctgcccgcctacctcaccccagat
gcccgggaccttgtcaaaaagtttctgaaacgtaatcccagccagcggattgggggtggc
ccaggggatgctgctgatgtgcagagacatccctttttccggcacatgaattgggacgac
cttctggcctggcgtgtggacccccctttcaggccctgtctgcagtcagaggaggacgtg
agccagtttgatacccgcttcacacggcagacgccagtggacagtcccgatgacacggcc
ctcagcgagagtgccaaccaggccttcctgggcttcacatacgtggcgccatctgtcctg
gacagcaaggaaggcttctccttccagcccaagctgcgctcacccaggcgcctcaacagt
agcccccgggcccccatcagccccctcaagttctccccttttgaggggtttcggcccagc
cccagcctgtcggagcccacggagccacctctacctccactcctgccgccaccgccgccg
ccaccctcgaccaccgcccctctccccatccgtcccccctcagggaccaagaagtccaag
aagggccgtgggcgtccagggcgctag

KEGG   Pongo abelii (Sumatran orangutan): 100462008
Entry
100462008         CDS       T01416                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: ribosomal protein S6 kinase beta-1
  KO
K04688  ribosomal protein S6 kinase beta [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04012  ErbB signaling pathway
pon04066  HIF-1 signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04213  Longevity regulating pathway - multiple species
pon04350  TGF-beta signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon04714  Thermogenesis
pon04910  Insulin signaling pathway
pon04931  Insulin resistance
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05170  Human immunodeficiency virus 1 infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05221  Acute myeloid leukemia
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100462008
   04350 TGF-beta signaling pathway
    100462008
   04371 Apelin signaling pathway
    100462008
   04066 HIF-1 signaling pathway
    100462008
   04151 PI3K-Akt signaling pathway
    100462008
   04152 AMPK signaling pathway
    100462008
   04150 mTOR signaling pathway
    100462008
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100462008
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    100462008
  09152 Endocrine system
   04910 Insulin signaling pathway
    100462008
  09149 Aging
   04211 Longevity regulating pathway
    100462008
   04213 Longevity regulating pathway - multiple species
    100462008
  09159 Environmental adaptation
   04714 Thermogenesis
    100462008
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100462008
   05205 Proteoglycans in cancer
    100462008
   05231 Choline metabolism in cancer
    100462008
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100462008
  09162 Cancer: specific types
   05210 Colorectal cancer
    100462008
   05212 Pancreatic cancer
    100462008
   05225 Hepatocellular carcinoma
    100462008
   05226 Gastric cancer
    100462008
   05221 Acute myeloid leukemia
    100462008
   05224 Breast cancer
    100462008
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100462008
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100462008
   05163 Human cytomegalovirus infection
    100462008
   05165 Human papillomavirus infection
    100462008
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100462008
   01522 Endocrine resistance
    100462008
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100462008
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100462008
Protein kinases [BR:pon01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   100462008
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_C Kinase-like Pkinase_fungal APH Kdo Seadorna_VP7
Other DBs
NCBI-GeneID: 100462008
NCBI-ProteinID: XP_024097267
LinkDB
Position
17
AA seq 330 aa
MIVRNAKDTAHTKAEWNILEEVKHPFIVDLICAFQTGGKLYLILEYLSGQRRTIYAVREG
ISMEDTACFYLAEISMALGHLHQKGIIYRDLKPENIMLNHQGHVKLTDFGLCKESIHDGT
VTHTFCGTIEYMAPEILMRSGHNRAVDWWSLGALMYDMLTGAPAFTGENRKKTIDNILKC
KLXLPHYLTQEARDLLKKLLKRNAASHLGAGPGDAGEVQAHPFFRHINWEELLAQKVEPP
FKPLLQSEEDVSQSDSKFTRQTPVDSPDDSTLSESANQVFLGFTYAAPSVLXSVKEKFSF
EPKIRSPRRFIGSPQTPVSSIRFSPFSIYR
NT seq 993 nt   +upstreamnt  +downstreamnt
atgatagtaagaaatgctaaagatacagctcatacaaaagcagaatggaatattctggaa
gaagtgaagcatcccttcatcgtggatttaatttgtgcctttcagactggtggaaaactc
tacctcatccttgagtatctcagtggtcagaggagaactatttatgcagttagagaggga
atatctatggaagacactgcctgcttttacttggcagaaatctccatggctttggggcat
ttacatcaaaaggggatcatctacagagacttgaagccggagaatatcatgcttaatcac
caaggtcatgtgaaactaacagactttggactatgcaaagaatctattcatgatggaaca
gtcacacacacattttgtggaacaatagaatatatggcccctgaaatcttgatgagaagt
ggccacaatcgtgctgtggattggtggagtttgggagcattaatgtatgacatgctgact
ggagcacccgcatttactggggagaatagaaagaaaacaattgacaacatcctcaaatgt
aaactanatttgcctcactacctcacacaagaagccagagatctgcttaaaaagctactg
aaaagaaatgctgcttctcatctgggagctggtcctggggatgctggagaagttcaagct
catccattctttagacacattaactgggaagaacttctggctcaaaaggtggagcccccc
tttaaacctctgttgcaatctgaagaggatgtaagtcagtctgattccaagtttacacgt
cagacacctgtcgacagcccagatgactcaactctcagtgaaagtgccaatcaggtcttt
ctgggttttacatatgcggctccatctgtacttngaagtgtgaaagaaaagttttccttt
gaaccaaaaatccgatcacctcgaagatttattggcagcccacaaacacctgtcagctcc
attagattttctcccttttcaatttataggtaa

DBGET integrated database retrieval system