KEGG   Pongo abelii (Sumatran orangutan): 100457204
Entry
100457204         CDS       T01416                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1
  KO
K16366  endothelin-1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04066  HIF-1 signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04270  Vascular smooth muscle contraction
pon04668  TNF signaling pathway
pon04916  Melanogenesis
pon04924  Renin secretion
pon04926  Relaxin signaling pathway
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon05200  Pathways in cancer
pon05410  Hypertrophic cardiomyopathy
pon05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    100457204 (EDN1)
   04066 HIF-1 signaling pathway
    100457204 (EDN1)
   04024 cAMP signaling pathway
    100457204 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100457204 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    100457204 (EDN1)
   04916 Melanogenesis
    100457204 (EDN1)
   04924 Renin secretion
    100457204 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    100457204 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457204 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    100457204 (EDN1)
   05410 Hypertrophic cardiomyopathy
    100457204 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    100457204 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 100457204
NCBI-ProteinID: XP_002816476
Ensembl: ENSPPYG00000016237
UniProt: H2PHY3
LinkDB
Position
6
AA seq 212 aa
MDYLPMIFSLLFVACQGAPETAVLGAELSTVGENGGEKPTPSPPWRLRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGNPRSKRALENFLPTKATDRENRCQCASQKDKKCW
NFCQAGKELRAEDTTEKGWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSSEEHLRQTRSE
TMRNSIKSIFHDPKLKGEPSRERYVTHNRAHW
NT seq 639 nt   +upstreamnt  +downstreamnt
atggattatttgcccatgattttttctctgctgtttgtggcttgccaaggagctccagaa
acagcggtcttaggcgctgagctcagcacggtgggtgagaacggcggggagaaacccact
cccagtccaccctggcggctccgccggtccaagcgctgctcctgctcgtccctgatggat
aaagagtgtgtctacttctgccacctggacatcatttgggtcaacactcccgagcacgtt
gttccatatggacttggaaaccctaggtccaagagagccttggagaatttccttcccaca
aaggcaacagaccgcgagaatagatgccaatgtgctagccaaaaagacaagaagtgctgg
aatttttgccaagcaggaaaagaactcagagctgaagacactacggagaaaggctggaat
aatcataagaaaggaaaagactgttccaagcttgggaaaaagtgtatttatcagcagtta
gtgagaggaagaaaaatcagaagaagttcagaggaacacctaagacaaaccaggtcggag
accatgagaaacagcatcaaatcaatttttcatgatcccaagctgaaaggcgagccctcg
agagagcgttatgtgacccacaaccgagcacattggtga

DBGET integrated database retrieval system