KEGG   Pongo abelii (Sumatran orangutan): 100457433
Entry
100457433         CDS       T01416                                 

Definition
(RefSeq) 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial
  KO
K07436  vitamin D3 24-hydroxylase [EC:1.14.15.16]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00100  Steroid biosynthesis
pon01100  Metabolic pathways
pon04928  Parathyroid hormone synthesis, secretion and action
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    100457433
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    100457433
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100457433
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:pon00199]
    100457433
Enzymes [BR:pon01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.15  With reduced iron-sulfur protein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.15.16  vitamin D3 24-hydroxylase
     100457433
Cytochrome P450 [BR:pon00199]
 Cytochrome P450, animal type
  CYP24 family
   100457433
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 100457433
NCBI-ProteinID: XP_002830483
Ensembl: ENSPPYG00000011143
UniProt: A0A663DIQ1 H2P2C1
LinkDB
Position
20
AA seq 514 aa
MSSPISKNRSLAAFLKQLRSPRQPPRPVTSTAYTSPQPREVPVCPLTAGGETQNAAALPG
PTSWPLLGSLLQILWKGGLKKQHDTLVEYHKKYGKIFRMKLGSFESVHLGSPCLLEALYR
TESAYPQRLEIKPWKAYRDYRKEGYGLLILEGEDWQRVRSAFQKKLMKPVEVMKLDNKIN
EVLADFMGRIDELCDERGHIEDLYSELNKWSFESICLVLYEKRFGLLQKNAGDEAVNFIV
AIKTMMSTFGRMMVTPVELHKSLNTKVWQDHTLAWDTIFKSVKSCIDNRLEKYSQQSSAD
FLCDIYHQNRLSKKELYAAVTELQLAAVETTANSLMWILYNLSRNPQVQQKLLKEIQSVL
PENQVPRAEDLRNMPYLKACLKESMRLTPSVPFTTRTLDKATVLGEYALPKGTVLMLNTQ
VLGSSEDNFEDSSQFRPERWLQEKGKINPFAHLPFGIGKRMCIGRRLAELQLHLALCWIV
RKYDIQATDNEPVEMLHSGTLVPSRELPIAFCQR
NT seq 1545 nt   +upstreamnt  +downstreamnt
atgagctcccccatcagcaagaaccgctcgcttgccgccttcctgaagcagctgcgcagt
ccgagacagcccccgagaccggtgacatctacggcgtacacgtcccctcagccgcgagag
gtgccagtctgcccgctgacagctggtggcgagactcagaacgcagccgccctgccgggc
cccaccagctggccactgctgggcagcctgctgcagattctctggaaaggggggctcaag
aaacagcacgacaccctggtggagtaccacaaaaagtacggcaagattttccgcatgaag
ttgggttcctttgagtcggtgcacctgggctcgccatgcctgctggaagcactgtaccgc
accgagagcgcgtacccgcagcggctggagatcaaaccgtggaaggcctatcgcgactac
cgcaaagaaggctacgggctgctgatcctggaaggggaagactggcagcgggtccggagt
gcctttcaaaagaaactaatgaaaccagtggaagtgatgaagctggacaacaaaatcaat
gaggtcttggctgattttatgggcagaatagatgagctctgtgatgaaagaggccacatt
gaagacttgtacagcgaactgaacaaatggtcgtttgaaagtatctgcctcgtgttgtat
gagaagagatttgggcttctccagaagaatgcaggggatgaagctgtgaacttcatcgtg
gccatcaaaacaatgatgagcacgtttgggagaatgatggtcactccagtcgagctgcac
aagagcctcaacaccaaggtctggcaggaccacactctggcctgggacaccattttcaaa
tcagtcaaatcttgtatcgacaaccggttagagaagtattctcagcagtctagtgcagat
ttcctttgtgacatttatcaccagaatcggctttcaaagaaagaattgtatgctgctgtc
acagagctccagctggctgcagtggaaacgacagcaaacagtctaatgtggattctctac
aatttatcccgtaatccccaagtgcaacaaaaacttcttaaggaaattcaaagtgtatta
cctgagaatcaggtgccacgggcagaagatttgaggaatatgccgtatttaaaagcctgt
ctgaaagaatctatgaggcttacgccgagtgtaccatttacaactcggactcttgacaag
gcaacagttctgggtgaatatgctttacccaaaggaacagtgctgatgctaaatacccag
gtgttgggatccagtgaagacaattttgaagattcaagtcagtttagacctgaacgttgg
cttcaggagaagggaaaaattaatccttttgcgcatcttccatttggcattggaaaaaga
atgtgcattggtcgccgattagcagagcttcaactgcatttggctctttgttggattgtc
cgcaaatatgacatccaggccacagacaatgagcctgttgagatgctacactcaggcacc
ctggtgcccagccgggagctccccatcgcgttttgccagcgataa

DBGET integrated database retrieval system