KEGG   Pongo abelii (Sumatran orangutan): 100457942
Entry
100457942         CDS       T01416                                 

Gene name
FZD3
Definition
(RefSeq) frizzled-3
  KO
K02329  frizzled 3
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04150  mTOR signaling pathway
pon04310  Wnt signaling pathway
pon04360  Axon guidance
pon04390  Hippo signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04916  Melanogenesis
pon04934  Cushing syndrome
pon05010  Alzheimer disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05217  Basal cell carcinoma
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    100457942 (FZD3)
   04390 Hippo signaling pathway
    100457942 (FZD3)
   04150 mTOR signaling pathway
    100457942 (FZD3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100457942 (FZD3)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    100457942 (FZD3)
  09158 Development and regeneration
   04360 Axon guidance
    100457942 (FZD3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100457942 (FZD3)
   05206 MicroRNAs in cancer
    100457942 (FZD3)
   05205 Proteoglycans in cancer
    100457942 (FZD3)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100457942 (FZD3)
   05226 Gastric cancer
    100457942 (FZD3)
   05217 Basal cell carcinoma
    100457942 (FZD3)
   05224 Breast cancer
    100457942 (FZD3)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100457942 (FZD3)
   05022 Pathways of neurodegeneration - multiple diseases
    100457942 (FZD3)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100457942 (FZD3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100457942 (FZD3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:pon04030]
    100457942 (FZD3)
G protein-coupled receptors [BR:pon04030]
 Frizzled / Smoothened family
  100457942 (FZD3)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 100457942
NCBI-ProteinID: XP_002818999
Ensembl: ENSPPYG00000018477
UniProt: A0A6D2W8K8 A0A2J8X5B0
LinkDB
Position
8
AA seq 666 aa
MAMTWIVFSFWPLTVFMGHIGGHSLFSCEPITLRMCQDLPYNTTFMPNLLNHYDQQTAAL
AMEPFHPMVNLDCSRDFRPFLCALYAPICMEYGRVTLPCRRLCQRAYSECSKLMEMFGVP
WPEDMECSRFPDCDEPYPRLVDLNLAGEPTEGAPVAVQRDYGFWCPRELKIDPDLGYSFL
HVRDCSPPCPNMYFRREELSFARYFIGLISIICLSATLFTFLTFLIDVTRFRYPERPIIF
YAVCYMMVSLIFFIGFLLEDRVACNASIPAQYKASTVTQGSHNKACTMLFMILYFFTMAG
SVWWVILTITWFLAAVPKWGSEAIEKKALLFHASAWGIPGTLTIILLAMNKIEGDNISGV
CFVGLYDVDALRYFVLAPLCLYVVVGVSLLLAGIISLNRVRIEIPLEKENQDKLVKFMIR
IGVFSILYLVPLLVVIGCYFYEQANRGIWETTWIQERCREYHIPCPYQVTQMSRPDLILF
LMKYLMALIVGIPSVFWVGSKKTCFEWASFFHGRRKKEIVNESRQVLQEPDFAQSLLRDP
NTPIIRKSRGTSTQGTSTHASSTQLAMVDDQRSKAGSIHSKVSSYHGSLHRSRDGRYTPC
SYRGMEERLPHGSMSRLTDHSRHSSSHRLNEQSRHSSIRDLSNNPMTHITHGTSMNRVIE
EDGTSA
NT seq 2001 nt   +upstreamnt  +downstreamnt
atggctatgacttggattgtcttctctttttggcccttgactgtgttcatggggcatata
ggtggtcacagtttgttttcttgtgaacccattaccttgaggatgtgccaagatttgcct
tataatactaccttcatgcctaatcttctgaatcattatgaccaacagacagcagctttg
gcaatggagccattccatcctatggtgaatctggattgttctcgggatttccggcctttt
ctttgtgcactctatgctcctatttgtatggaatatggacgtgtcacacttccctgtcgt
aggctgtgtcagcgggcttacagtgagtgttcgaagctcatggagatgtttggtgttcct
tggcctgaagatatggaatgcagtaggttcccagattgtgatgagccgtatcctcgactt
gtggatctgaatttagctggagaaccaactgaaggagccccagtggcagtgcagagagac
tatggtttttggtgtccccgagagttaaaaattgatcctgatctgggttattcttttctg
cacgtgcgtgattgttcacctccttgtccaaatatgtacttcagaagagaagaactgtca
tttgctcgctatttcataggattgatttcaatcatttgcctctcagccacattgtttact
tttttaacttttttgattgatgtcacaagattccgttatcctgaaaggcctattatattt
tatgcagtctgctacatgatggtatccttaattttcttcattggatttttgcttgaggat
cgagtagcctgcaatgcatccatccctgcacaatataaggcttccacagtgacacaagga
tctcataataaagcctgtaccatgctttttatgatactctatttttttactatggctggc
agtgtatggtgggtaattcttaccatcacatggtttttagcagctgtgccaaagtggggt
agtgaagctattgagaagaaagcattgctgtttcacgccagtgcatggggcatccccgga
actctaaccatcatccttttagcgatgaataaaattgaaggtgacaatattagtggcgtg
tgttttgttggcctctacgatgttgatgcattgagatattttgttcttgctcccctctgc
ctgtatgtggtagttggggtttctctcctcttagctggcattatatccctaaacagagtt
cgaattgagattccattagaaaaggagaaccaagataaattagtgaagtttatgatccgg
atcggtgttttcagcattctttatctcgtaccactcttggtggtaattggatgctacttt
tatgagcaagctaaccggggcatctgggaaacaacgtggatacaagaacgctgcagagaa
tatcacattccatgtccatatcaggttactcaaatgagtcgtccagacttgattctcttt
ctgatgaaatacctgatggctctcatagttggcattccctctgtattttgggttggaagc
aaaaagacatgctttgaatgggccagtttttttcatggtcgtaggaaaaaagagatagtg
aatgagagccgacaggtactccaggaacctgattttgctcagtctctcctgagggatcca
aatactcctatcataagaaagtcaaggggaacttccactcaaggaacatccacccatgct
tcttcaactcagctggctatggtggatgatcaaagaagcaaagcgggaagcatccacagc
aaagtgagcagctaccacggcagcctccacagatcacgtgatggcaggtacacaccctgc
agttacagaggaatggaggagagactacctcatggcagcatgtcacgactaacagaccac
tccaggcatagtagttctcatcggctcaatgaacagtcacgacatagcagcatcagagat
ctcagtaataatcccatgactcacatcacacatggcaccagcatgaatcgggttattgaa
gaagatggaaccagtgcttaa

DBGET integrated database retrieval system