KEGG   Pongo abelii (Sumatran orangutan): 100458096
Entry
100458096         CDS       T01416                                 

Gene name
PIK3AP1
Definition
(RefSeq) phosphoinositide 3-kinase adapter protein 1
  KO
K12230  phosphoinositide 3-kinase adapter protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04151  PI3K-Akt signaling pathway
pon04662  B cell receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100458096 (PIK3AP1)
 09150 Organismal Systems
  09151 Immune system
   04662 B cell receptor signaling pathway
    100458096 (PIK3AP1)
SSDB
Motif
Pfam: DBB TIR_3 OmpH
Other DBs
NCBI-GeneID: 100458096
NCBI-ProteinID: XP_024109990
Ensembl: ENSPPYG00000002522
LinkDB
Position
10
AA seq 805 aa
MAASGVPRGCDILIVYSPDAEEWCQYLQTLFLSSRQVRSQKILTHRLGPEASFSAEDLSL
FLSTRCVVVLLSAELVQHFHKPALLPLLQRAFHPPHRVVRLLCGVRDSEEFLDFFPDWAH
WQELTCDDEPETYVAAVKKAISEDSGCDSVTDTEPEDEKVVSYSKQQSLPTVTSPGNLMV
VQPDRIRCGAETTVYVIVRCKLDDRVATEAEFSPEDSPSVRMEAKLENEYTISVKAPNLS
SGNVSLKIYSGDLVVCETIISYYTDMEEIGNLLSNAANPVEFMCQAFKIVPYNTETLDKL
LTESLKNNIPASGLHLFGINQLEEEDMMTNQRDEELPTLLHFAAKYGLKNLTALLLTCPG
ALQAYSVANKHGHYPNTIAEKHGFRDLRQFIDEYVETVDMLKSHIKEELMQGEEADAVYE
SMAHLSTDLLMKCSLNPGCDEDLYESMAAFVPAATEDLYVEMLQASTSNPIPGDGFSQAT
KDSMIRKFLEGNSMGMTNLERDQSHLGQEEDVYHTVDDDEAFSVDLASRPPVPVPRPETT
APGAHQLPDNEPYIFKVFAEKSQERPGNFYVSSESIRKGPPVRPWRDRPQSSIYDPFAGM
KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRR
QREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRKSVIPPRTELRRGDWKTDSTS
STASSTSNRSSTRSLLSVSSGMEGDNEDNEVPEVTRSRSPGPPQVDGTPTMSLERPPRVP
PRAASQRPPTRETFHPPPPVPPRGR
NT seq 2418 nt   +upstreamnt  +downstreamnt
atggcagcctcaggggtgcccagaggatgcgacatcctcatcgtctatagcccggatgcc
gaggaatggtgccagtacctgcagaccctgttcctgtctagtcggcaggtccgcagccag
aagatactgactcacaggctgggccccgaggcctccttctcggcagaggacctaagcctt
ttcctcagcactcgctgtgtcgtggtgctgctgtccgcagagctggtgcagcacttccac
aagcccgccttgctgcccctgctgcagagagccttccatcctccgcaccgcgtggtcagg
ctgctctgcggcgtgcgggacagcgaggagttcctagacttctttccagattgggcccac
tggcaggagctcacctgtgacgatgagccagagacctacgtggcagctgtgaaaaaagcc
atttctgaagattctggctgtgactcagtcactgacactgagcctgaggacgagaaggtt
gtttcctactcgaagcagcagagcctgccgacggtgacttcgcctgggaacctgatggtg
gtgcagccggaccgcattcgctgtggggcagaaaccactgtctacgttattgtgagatgt
aagttggatgacagggtggcgacggaagcagagttttctcctgaggattctccctctgta
aggatggaagccaagctggagaatgagtacaccatttccgtgaaggctcccaacctttca
tctgggaacgtttctctgaagatatattctggggacttagtggtgtgtgaaaccattatc
agctattatactgacatggaagaaattgggaatttattgtccaatgccgcgaatcctgtg
gaattcatgtgtcaggcctttaaaattgtgccctacaacacagagacccttgataaactg
ctaaccgaatccctgaagaacaatatccctgcaagcggactgcacctctttggaatcaac
cagctggaagaagaagatatgatgacaaatcagagggatgaagagctgcccaccctgttg
cattttgctgcaaagtatggactgaagaacctcactgccttgttgctcacctgcccagga
gccctgcaggcatacagcgtggccaacaagcatggccactaccccaacaccatcgctgag
aaacacggcttcagggacctacggcagttcatcgacgagtatgtggaaacggtggacatg
ctcaagagtcacattaaagaggaactgatgcaaggggaggaggctgacgctgtgtacgag
tccatggcccacctttccacagacctgcttatgaaatgctcgctcaaccctggctgtgac
gaggatctctatgagtccatggctgcctttgtcccagctgccactgaagacctctatgtt
gaaatgcttcaggccagtacatctaacccaatccctggagatggtttctctcaggccact
aaggactctatgatccgcaagtttttagaaggcaacagcatgggaatgaccaatctggag
agagatcagagccatcttggtcaggaagaagacgtttatcacacggtggatgatgatgag
gccttttctgtggacctggccagcaggccccctgtcccagtgcccagaccagagaccact
gctcctggtgctcaccagctgcctgacaacgagccatacatttttaaagtttttgcagaa
aaaagtcaagagcggcctgggaatttctacgtttcctcagagagcatcaggaaagggccg
cccgtcagaccatggagggacaggccccagtcgagtatatatgacccttttgcggggatg
aaaacgccaggccagcggcagcttatcaccctccaggagcaggtgaagctgggcattgtc
aatgtggatgaggctgtgctccacttcaaagagtggcagctcaaccagaagaaacgatcg
gagtcctttcgtttccagcaggaaaatcttaaacggctaagagacagcatcacccgaaga
cagagagagaagcaaaaatcaggaaagcagacagacttggagatcacggtcccaattcgg
cactcacagcacctgcctgcaaaagtggagtttggagtctatgagagtggccccaggaaa
agtgtcattccccccaggacggagctgagacgaggagactggaaaacagacagcacctcc
agcacagcaagtagcacgagtaaccgctccagcacccggagcctcctcagtgtgagcagc
gggatggaaggggacaacgaggacaatgaagtccctgaggttaccagaagtcgcagtcca
ggccccccacaagtggatgggacacccaccatgtccctcgagagaccccccagggtgcct
ccgagagctgcctcacagaggcctccgaccagggagaccttccatcctcctccacctgtt
ccacccagaggacgctga

DBGET integrated database retrieval system