KEGG   Pongo abelii (Sumatran orangutan): 100458106
Entry
100458106         CDS       T01416                                 

Gene name
AGT
Definition
(RefSeq) angiotensinogen
  KO
K09821  angiotensinogen
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04072  Phospholipase D signaling pathway
pon04080  Neuroactive ligand-receptor interaction
pon04261  Adrenergic signaling in cardiomyocytes
pon04270  Vascular smooth muscle contraction
pon04614  Renin-angiotensin system
pon04924  Renin secretion
pon04925  Aldosterone synthesis and secretion
pon04927  Cortisol synthesis and secretion
pon04931  Insulin resistance
pon04933  AGE-RAGE signaling pathway in diabetic complications
pon04934  Cushing syndrome
pon05200  Pathways in cancer
pon05410  Hypertrophic cardiomyopathy
pon05414  Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04072 Phospholipase D signaling pathway
    100458106 (AGT)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100458106 (AGT)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    100458106 (AGT)
   04614 Renin-angiotensin system
    100458106 (AGT)
   04925 Aldosterone synthesis and secretion
    100458106 (AGT)
   04927 Cortisol synthesis and secretion
    100458106 (AGT)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100458106 (AGT)
   04270 Vascular smooth muscle contraction
    100458106 (AGT)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100458106 (AGT)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy
    100458106 (AGT)
   05414 Dilated cardiomyopathy
    100458106 (AGT)
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100458106 (AGT)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100458106 (AGT)
   04934 Cushing syndrome
    100458106 (AGT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100458106 (AGT)
Peptidases and inhibitors [BR:pon01002]
 Peptidase inhibitors
  Family I4: serpin family
   100458106 (AGT)
SSDB
Motif
Pfam: Serpin
Other DBs
NCBI-GeneID: 100458106
NCBI-ProteinID: XP_002809355
Ensembl: ENSPPYG00000000120
UniProt: H2N3F2
LinkDB
Position
1
AA seq 485 aa
MRKRAPQSEMAPAGMSLRATILCLLAWAGLAAGDRVYIHPFHLVIHNESTCEQLAKANAG
KPKDPTFIPVPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGM
HSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKV
LSALQAVQGLLVAQGRADSQAQLLLSTVVGVFTAPGLHLKQPFVQGLALYTPVVLPRSLD
FTELDVAGEKIDRFMKAVTGWKTGCSLTGASVDSTLAFNTYVHFQGKMKGFSLLAEPQEF
WVDNSTSVSVPMLSGMGTFQHWSDAQDNFSVTQVPFTESACLLLIQPHYASDLDKVEGLT
FQQNSLNWMKKLSPRAIHLTMPRLVLQGSYDLQDLLAQAELPAILHTELNLQKLSNDRLR
VGEVLNSIFFELEADEREPTESTQELNRPEVLEVTLNRPFLFAVYDQSATALHFLGRVAN
PLSTA
NT seq 1458 nt   +upstreamnt  +downstreamnt
atgcggaagcgagcaccccagtctgagatggctcctgccggcatgagcctgagggccacc
atcctctgcctcctggcctgggctggcctggctgcaggtgaccgggtgtacatacacccc
ttccacctcgtcatccacaacgagagtacctgtgagcagctggcaaaggccaatgccggg
aagcccaaagatcccaccttcatacctgttccgattcaggccaagacatcccctgtggat
gaaaaggccctacaggaccagctggtgctagtcgctgcaaaactcgacaccgaagacaag
ttgagggccgcgatggtcgggatgctagccaacttcttgggcttccgtatatatggcatg
cacagtgagctatggggtgtggtccatggggccactgtcctctccccaacggctgtcttt
ggcaccctggcctctctctacctgggagccttggaccacacagctgacaggctacaggca
atcctgggtgttccttggaaggacaagaactgcacctcccggctggatgcgcacaaggtc
ctctctgccctgcaggctgtacagggtctgctggtggcccagggcagggctgatagccag
gcccagctgctgctgtccacggtggtgggcgtgttcacagccccaggcctgcacttgaag
cagccgtttgtgcagggcctggctctctatacccctgtggtcctcccacgctctctggac
ttcacagaactggatgtcgctggtgagaagattgataggttcatgaaagctgtgacagga
tggaagactggctgctccctgacgggagccagtgtggacagcaccctggctttcaacacc
tacgtccactttcaagggaagatgaagggcttctccctgctggccgagccccaggagttc
tgggtggacaacagcacctcagtgtctgttcccatgctctctggcatgggcaccttccag
cactggagtgatgcccaggacaacttctcggtgactcaagtgcccttcactgagagcgcc
tgcctgctgctgatccagcctcactacgcctctgacctggacaaggtggagggtctcact
ttccagcaaaactccctcaactggatgaagaaactgtctccccgggccatccacctgacc
atgccccgactggtgctgcaaggatcttatgacctgcaggacctgctcgcccaggctgag
ctgcctgccattctgcacaccgagctgaacctgcaaaaattgagcaatgaccgcctcagg
gtgggggaggtgctgaacagcattttttttgaacttgaagcggatgagagagagcccacc
gagtctacccaagagcttaacaggcctgaggtcttggaggtgaccctgaaccgcccattc
ctgtttgctgtgtatgatcaaagcgccactgccctgcacttcctgggccgcgtggccaac
ccgctgagcacagcgtga

DBGET integrated database retrieval system