KEGG   Pongo abelii (Sumatran orangutan): 100458178
Entry
100458178         CDS       T01416                                 

Gene name
EZR
Definition
(RefSeq) ezrin isoform X1
  KO
K08007  villin 2 (ezrin)
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
pon04810  Regulation of actin cytoskeleton
pon04971  Gastric acid secretion
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100458178 (EZR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100458178 (EZR)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100458178 (EZR)
  09154 Digestive system
   04971 Gastric acid secretion
    100458178 (EZR)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100458178 (EZR)
   05205 Proteoglycans in cancer
    100458178 (EZR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:pon04812]
    100458178 (EZR)
   04147 Exosome [BR:pon04147]
    100458178 (EZR)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Gelsolin / villin
     100458178 (EZR)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100458178 (EZR)
SSDB
Motif
Pfam: ERM FERM_C FERM_M FERM_N
Other DBs
NCBI-GeneID: 100458178
NCBI-ProteinID: XP_002817572
Ensembl: ENSPPYG00000017137
UniProt: A0A6D2XPS5 A0A2J8XAX6
LinkDB
Position
6
AA seq 586 aa
MPKPINVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWYFGLQYMDNKGFPTWLK
LDKKVSAQEVRKENPLQFKFRAKFYPEDVAEELIQDITQKLFFLQVKEGILSDEIYCPPE
TAVLLGSYAVQAKFGDYNKEVHKSGYLSSERLIPQRVMDQHKLTRDQWEDRIQVWHAEHR
GMLKDNAMLEYLKIAQDLEMYGINYFEIKNKKGTDLWLGVDALGLNIYEKDDKLTPKIGF
PWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILQLCMGNHELYMRRRKPDTI
EVQQMKAQAREEKHQKQLERQQLETEKKRRETVEREKEQMMREKEELMLRLQDYEEKTKK
AERELSEQIQRALQLEEERKRAQEEAERLEADRMAALRAKEELERQAVDQIKSQEQLAAE
LAEYTAKIALLEEARRRKEDEVEEWQHRAKEAQDDLVKTKEELHLVMTAPPPPPPPVYEP
VSYHVQESLQDEGAEPTGYSAELSSEGIRDDRNEEKRITEAEKNERVQRQLLTLSSELSQ
ARDENKRTHNDIIHNENMRQGRDKYKTLRQIRQGNTKQRIDEFEAL
NT seq 1761 nt   +upstreamnt  +downstreamnt
atgccgaaaccaatcaatgtccgagttaccaccatggatgcagagctggagtttgcaatc
cagccaaatacaactggaaaacagctttttgatcaggtggtgaagactatcggcctccgg
gaagtgtggtactttggcctccagtatatggataataaaggatttcctacctggctgaag
ctggataagaaggtgtctgcccaggaggtcaggaaggagaatcccctccagttcaagttc
cgggccaagttctaccctgaagatgtggctgaggagctcatccaggacatcacccagaaa
cttttcttcctccaagtgaaggagggaatccttagcgacgagatctactgcccccctgag
actgccgtgctcttggggtcttacgctgtgcaggctaagtttggggactacaacaaagaa
gtacacaagtctgggtacctcagctctgagcggctgatccctcaaagagtcatggaccag
cacaaacttaccagggaccagtgggaggaccggatccaggtgtggcatgcggaacaccgc
gggatgctcaaagataatgctatgttggaatacctgaagattgctcaggacctggaaatg
tatggaatcaactatttcgagataaaaaacaagaaaggaacagacctttggcttggagtt
gatgcccttgggctgaatatttacgagaaagatgataagttaaccccaaagattggcttt
ccttggagtgaaatcaggaacatctctttcaatgacaaaaagtttgtcattaaacccatc
gacaagaaggcacctgactttgtgttttatgccccgcgcctgagaatcaacaagcggatc
ctgcagctctgcatgggcaaccatgagctgtatatgcgccgcaggaagcctgacaccatc
gaagtgcagcagatgaaggcccaggcccgggaggagaagcatcagaagcagctggagcgg
caacagctggaaacagagaagaaaaggagagaaaccgtggagagagagaaagagcagatg
atgcgtgagaaggaagagctgatgctgcggctgcaggactatgaggagaagacaaagaag
gcggagagagagctctcagagcagattcagagggccctgcagctggaggaggagaggaag
cgggcacaggaggaggccgagcgcctagaggctgaccgtatggctgcactgcgggctaag
gaggagctggagagacaggcggtggatcagataaagagccaggagcagctggctgcggag
cttgcagaatacactgccaagattgccctcctggaagaggcgcggaggcgcaaggaggat
gaggttgaagagtggcagcacagggccaaagaagcccaggatgacctggtgaagaccaag
gaggagctgcacctggtaatgacagcacccccgcccccaccgccccccgtgtacgagccg
gtgagctaccatgtccaggagagcttgcaggatgagggcgcggagcccacgggctacagc
gcggagctgtctagtgagggcatccgggatgaccgcaatgaggagaagcgcatcactgag
gcagagaagaacgagcgtgtgcagcggcagctgctgacactgagcagcgagctgtcccag
gcccgagatgagaataagaggacccacaatgacatcatccacaacgagaacatgaggcaa
ggccgggacaagtacaagacgctgcggcagatccggcagggcaacaccaagcagcgcatc
gatgagttcgaggccctgtaa

DBGET integrated database retrieval system