KEGG   Pongo abelii (Sumatran orangutan): 100458884
Entry
100458884         CDS       T01416                                 

Gene name
GAB1
Definition
(RefSeq) GRB2-associated-binding protein 1 isoform X1
  KO
K09593  GRB2-associated-binding protein 1
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04072  Phospholipase D signaling pathway
pon04722  Neurotrophin signaling pathway
pon05100  Bacterial invasion of epithelial cells
pon05205  Proteoglycans in cancer
pon05211  Renal cell carcinoma
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    100458884 (GAB1)
   04014 Ras signaling pathway
    100458884 (GAB1)
   04072 Phospholipase D signaling pathway
    100458884 (GAB1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100458884 (GAB1)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    100458884 (GAB1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    100458884 (GAB1)
   05226 Gastric cancer
    100458884 (GAB1)
   05211 Renal cell carcinoma
    100458884 (GAB1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    100458884 (GAB1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100458884 (GAB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:pon04990]
    100458884 (GAB1)
Domain-containing proteins not elsewhere classified [BR:pon04990]
 Pleckstrin homology (PH) domain-containing proteins
  Grb-2 associated binder (Gab) family proteins
   100458884 (GAB1)
SSDB
Motif
Pfam: PH PH_11 PH_9 PH_8 PH_3 PH_13
Other DBs
NCBI-GeneID: 100458884
NCBI-ProteinID: XP_002815218
Ensembl: ENSPPYG00000015090
UniProt: H2PEE0
LinkDB
Position
4
AA seq 724 aa
MSGGEVVCSGWLRKSPPEKKLKRYAWKRRWFVLRSGRLTGDPDVLEYYKNDHAKKPIRII
DLNLCQQVDAGLTFNKKEFENSYIFDINTIDRIFYLVADSEEEMNKWVRCICDICGFNPT
EEDPVKPPGSSLQAPADLPLAINTAPPSTQADSSSATLPPPYQLINVPPHLETLGIQEDP
QDYLLLINCQSKKPEPTRTHADSAKSTSSETDCNDNVPSHKNPASSQSKHGMNGFFQQQM
IYDSPPSRAPSASVDSSLYNLPRSYSHDVLPKMSPSSTEADGELYVFNTPSGTSSVETQM
RHVSISYDIPPTPGNTYQIPRTFPEGTLGQTSKLDTIPDIPPPRPPKPHPAHDRSPVETC
SIPRTASDTDSSYCIPTAGMSPSRSNTISTVDLNKLRKDASSQDCYDIPRTFPSDRSSSL
EGFHNHFKVKNVLTVGSVSSEELDENYVPMNPNSPPRQHSSSFTEPIQEANYVPMTPGTF
DFSSFGMQVPPPAHMGFRSSPKTPPRRPVPVADCEPPPVDRNLKPDRKGQSPKILRLKPH
GLERTDSQTIGDFATRRKVKPAPLEIKPLPEWEELQAPVRSPITRSFARDSSRFPMSPRP
DSVHSTTSSSDSHDSEENYVPMNPNLSSEDPNLFGSNSLDGGSSPMIKPKGDKQVEYLDL
DLDSGKSTPPRKQKSSGSGSSVADERVDYVVVDQQKTLALKSTREAWTDGRQSTESETPT
KSVK
NT seq 2175 nt   +upstreamnt  +downstreamnt
atgagcggtggtgaagtggtctgctccggatggctccgcaagtctcccccggagaaaaag
ttgaagcgttatgcatggaagaggagatggttcgtgttacgcagtggccgtttaactgga
gatccagatgttttggaatattacaaaaatgatcatgccaagaagcctattcgtattatt
gatttaaatttatgtcaacaagtagatgctggattgacatttaacaaaaaagagtttgaa
aacagctacatttttgatatcaacactattgaccggattttctacttggtagcagacagc
gaggaggagatgaataagtgggttcgttgtatttgtgacatctgtgggtttaatccaaca
gaagaagatcctgtgaagccacctggcagctccttacaagcaccagctgatttaccttta
gctataaatacagcaccaccatccacccaggcagattcatcctctgctactctacctcct
ccgtatcagctaatcaatgttccaccacacctggaaactcttggcattcaggaggatcct
caagactacctgttactcatcaactgtcaaagcaagaagcccgaacccaccagaacgcac
gctgattctgcaaaatccacctcttctgaaacagactgcaatgataacgtcccttctcat
aaaaatcctgcttcctcccagagcaaacatggaatgaatggcttttttcagcagcaaatg
atatatgactctccaccttcacgtgccccatctgcttcagttgactccagcctttataac
ctgcccaggagttattcccatgatgttttaccaaagatgtctccatcaagtactgaagca
gatggagaactctatgtttttaataccccatctgggacatcgagtgtagagactcaaatg
aggcatgtatctattagttatgacattcctccaacacctggtaatacttatcagattcca
cgaacatttccagaaggaaccttgggacagacatcaaagctagacactattccagatatt
cctccacctcggccaccgaaaccacatccagctcatgaccgatctcctgtggaaacgtgt
agtatcccacgcaccgcctcagacactgacagtagttactgtatccctacagcagggatg
tcgccttcacgtagtaataccatttccactgtggatttaaacaaattgcgaaaagatgct
agttctcaagactgctatgatattccacgaacatttccaagtgatagatctagttcactt
gaaggcttccataaccactttaaagtcaaaaatgtgttgacagtgggaagtgtttcaagt
gaagaactggatgaaaattacgtcccaatgaatcccaattcaccaccacgacaacattcc
agcagttttacagaaccaattcaggaagcaaattatgtgccaatgactccaggaacattt
gatttttcctcatttggaatgcaagttcctcctcctgctcatatgggcttcaggtccagc
ccaaaaacccctcccagaaggccagttcctgttgcagactgtgaaccaccccccgtggat
aggaacctcaagccagacagaaaaggtcaaagtcctaaaattttaagactcaaaccccat
ggtttagagcgaactgattcacaaaccataggtgactttgctacaagaagaaaggtcaag
ccagcacctttagaaataaaacctttgccagaatgggaagaattacaagccccagttaga
tctcccatcactaggagttttgctcgagactcttctaggtttcccatgtccccccgacca
gattcagtgcatagcacaacttcaagcagtgactcacacgacagtgaagagaattatgtt
cccatgaacccaaacctgtccagtgaagacccaaatctctttggcagtaacagtcttgat
ggaggaagcagccctatgatcaagcccaaaggagacaaacaggtggaatacctagatctc
gacttagattctgggaaatccacaccaccacgtaagcaaaagagcagtggctcaggcagc
agtgtggcagatgagagagtggattatgttgttgttgaccaacagaagaccttggctcta
aagagtacccgggaagcctggacagatgggagacagtccacagaatcagaaacgccaacg
aagagtgtgaaatga

DBGET integrated database retrieval system