KEGG   Pongo abelii (Sumatran orangutan): 100459074
Entry
100459074         CDS       T01416                                 

Gene name
APAF1
Definition
(RefSeq) apoptotic protease-activating factor 1
  KO
K02084  apoptotic protease-activating factor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01524  Platinum drug resistance
pon04115  p53 signaling pathway
pon04210  Apoptosis
pon04215  Apoptosis - multiple species
pon05010  Alzheimer disease
pon05012  Parkinson disease
pon05014  Amyotrophic lateral sclerosis
pon05016  Huntington disease
pon05020  Prion disease
pon05022  Pathways of neurodegeneration - multiple diseases
pon05134  Legionellosis
pon05152  Tuberculosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05164  Influenza A
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05200  Pathways in cancer
pon05222  Small cell lung cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100459074 (APAF1)
   04215 Apoptosis - multiple species
    100459074 (APAF1)
   04115 p53 signaling pathway
    100459074 (APAF1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459074 (APAF1)
  09162 Cancer: specific types
   05222 Small cell lung cancer
    100459074 (APAF1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100459074 (APAF1)
   05012 Parkinson disease
    100459074 (APAF1)
   05014 Amyotrophic lateral sclerosis
    100459074 (APAF1)
   05016 Huntington disease
    100459074 (APAF1)
   05020 Prion disease
    100459074 (APAF1)
   05022 Pathways of neurodegeneration - multiple diseases
    100459074 (APAF1)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    100459074 (APAF1)
   05152 Tuberculosis
    100459074 (APAF1)
  09172 Infectious disease: viral
   05161 Hepatitis B
    100459074 (APAF1)
   05160 Hepatitis C
    100459074 (APAF1)
   05164 Influenza A
    100459074 (APAF1)
   05162 Measles
    100459074 (APAF1)
   05168 Herpes simplex virus 1 infection
    100459074 (APAF1)
   05169 Epstein-Barr virus infection
    100459074 (APAF1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100459074 (APAF1)
SSDB
Motif
Pfam: NB-ARC WD40 APAF1_C ANAPC4_WD40 CARD Ge1_WD40 eIF2A WD40_like CARD_2 Utp8 AAA_16 Hira AAA_22 NACHT AAA_18
Other DBs
NCBI-GeneID: 100459074
NCBI-ProteinID: XP_002823669
Ensembl: ENSPPYG00000004860
UniProt: A0A663D9B7 H2NIC5
LinkDB
Position
12
AA seq 1248 aa
MDAKARNCLLQHREALEKDIKTSYIMDHMISDGFLTISEEEKVRNEPTQQQRAAMLIKMI
LKKDNDSYISFYNALLHEGYKDLAALLHDGIPVVSSSSGKDSVSGITSYVRTVLCEGGVP
QRPVVFVTRKKLVNAIQQKLSKLKGEPGWVTIHGMAGCGKSVLAAEAVRDHSLLEGCFPG
GVHWVSVGKQDKSGLLMKLQNLCTRLDQDESFSQRLPLNIEEAKDRLRILMLRKHPRSLL
ILDDVWDSWVLKAFDNQCQILLTTRDKSVTDSVMGPKYVVPVESSLGKEKGLEILSLFVN
MKKADLPEQAHSIIKECKGSPLVVSLIGALLRDFPNRWEYYLKQLQNKQFKRIRKSSSYD
YEALDEAMSISVEMLREDIKDYYTDLSILQKDVKVPTKVLCILWDMETEEVEDILQEFVN
KSLLFCDRNGKSFRYYLHDLQVDFLTEKNCSQLQDLHKKIITQFQRYHQSHTLSPDQEDC
MYWYNFLAYHMASAKMHKELCALMFSLDWIKAKTELVGPAHLIHEFVEYRHILDEKDCAV
SENFQEFLSLNGHLLGRQPFPNIVQLGLCEPETSEVYQQAKLQAKQEVDNGMLYLEWINK
KNITNLSRLVVRPHTDAVYHACFSEDGQRIASCGADKTLQVFKAETGEKLLEIKAHEDEV
LCCAFSTDDRFIATCSVDKKVKIWNSMTGELVHTYDEHSEQVNCCHFTNSSHHLLLATGS
SDCFLKLWDLNQKECRNTMFGHTNSVNHCRFSPDDKLLASCSADGTLKLWDVTSANERKS
INVKQFFLNSEDPQEDMEVIVKCCSWSADGARIMVAAKNKIFLFDIHTSGLLGEIHTGHH
STIQYCDFSPQNHLAVVALSQYCVELWNIDSRSKVADCRGHLSWVHGVMFSPDGSSFLTS
SDDQTIRLWETKKVCKNSAVMLKQEVDVVFQENEVMVLAVDHIKRLQLINGKTGQIDYLT
EAQVSCCCLSPHLQYIAFGDENGAIEILELVNNRIFQSRFQHKKTVWHIQFTADEKTLIS
SSDDSEIQVWNWQLDKYIFLRGHQETVKDFRLLKNSRLLSWSFDGTVKVWNIITGNTEKD
FVCHQGTVLSCDISHDATKFSSTSADKTAKIWSFDHLLPLHELRGHNGCVRCSAFSVDST
LLATGDDNGEIRIWNVSNGELLHLCAPLSEEGAATHGGWVTDLCFSPDGKMLISAGGYIK
WWNVVTGESSQTFYTNGTNLKKIHVSPDFKTYVTVDNLGILYILQTLE
NT seq 3747 nt   +upstreamnt  +downstreamnt
atggatgcaaaagctcgaaattgtttgcttcaacatagagaagctctggaaaaggacatc
aagacatcctacatcatggatcacatgattagtgatggatttttaacaatatcagaagag
gaaaaagtaagaaatgagcccactcaacagcaaagagcagctatgctaattaaaatgata
cttaaaaaagataatgattcctacatatcgttctacaatgctctactacatgaaggatat
aaagatcttgctgcccttctccatgatggcattcctgttgtctcttcttccagtggtaaa
gattcagttagtggaataacttcatatgtaaggacagtcctgtgtgaaggtggagtacca
cagaggccagttgtttttgtcacaaggaagaagctggtgaatgcgattcagcagaagctc
tccaaattgaagggtgaaccaggatgggtcaccatacatggaatggcaggctgtgggaag
tctgtattagctgcagaagctgttagagatcattcccttttagaaggttgtttcccaggg
ggagtgcactgggtttcagttgggaaacaagacaaatctgggcttctgatgaaactgcag
aatctttgcacacggttggatcaggatgagagtttttcccagaggcttccacttaatatt
gaagaggctaaagaccgtctccgcattctgatgcttcgcaaacacccaaggtctctgttg
atcttggatgatgtttgggactcttgggtgttgaaagcttttgacaatcagtgtcagatt
cttcttacaaccagagacaagagtgttacagattcagtaatgggtcctaaatatgtagtc
cctgtggagagttccttaggaaaggaaaaaggacttgaaattttatccctttttgttaat
atgaagaaggcagatttgccagaacaagctcatagtattataaaagaatgtaaaggctct
ccccttgtagtatctttaattggtgcacttttacgtgattttcccaatcgctgggagtac
tacctcaaacagcttcagaataagcagtttaagagaataaggaaatcttcgtcttatgat
tatgaggctctagatgaagccatgtctataagtgttgaaatgctcagagaagacatcaaa
gattattacacagatctttccatccttcagaaggacgttaaggtgcctacaaaggtgtta
tgtattctctgggacatggaaactgaagaagttgaagacatactgcaggagtttgtaaat
aagtctcttttattctgtgatcggaatggaaagtcgtttcgttattatttacatgatctt
caagtagattttcttacagagaagaattgcagccagcttcaggatctacataagaagata
atcactcagtttcagagatatcaccagtcgcatactctttcaccagatcaggaagactgt
atgtattggtacaactttctggcctatcacatggccagtgccaagatgcacaaggaactt
tgtgctttaatgttttccctggattggattaaagcaaagacagaacttgtaggccctgct
catctgattcatgaatttgtggaatacagacatatactagatgaaaaggattgtgcagtc
agtgagaattttcaggagtttttatctttaaatggacaccttcttggacgacagccattt
cctaatattgtacaactgggtctctgtgagccggaaacttcagaagtttatcagcaagct
aagctgcaggccaagcaggaggtcgataatggaatgctttacctggaatggataaacaaa
aaaaacatcacgaatctttcccgcttagttgtccgcccccacacagatgctgtttaccat
gcctgcttttctgaggatggtcagagaatagcttcttgtggagctgataaaaccttacag
gtgttcaaagctgaaacaggagagaaacttttagaaatcaaggctcatgaggatgaagtg
ctttgttgtgcattctctacagatgacagatttatagcaacctgctcagtggataaaaaa
gtgaagatttggaattctatgaccggggaactagtacacacctatgatgagcactcagag
caagtcaattgctgccatttcaccaacagtagtcatcatcttctcttagccactgggtca
agtgactgcttcctcaaactttgggatttgaatcaaaaagaatgtcgaaataccatgttt
ggtcatacaaattcagtcaatcactgcagattttcaccagatgataagcttttggctagt
tgttcagctgatggaaccttaaagctttgggatgtgacatcagcaaatgagaggaaaagc
attaatgtgaaacagttcttcctaaattcagaggaccctcaagaggatatggaagtgata
gtgaagtgttgctcgtggtctgctgatggtgcaaggataatggtggcagcaaaaaataaa
atcttcctttttgacattcataccagtggcctattgggagaaatccacacgggccatcac
agcaccatccagtactgtgacttctccccacaaaaccatttggcagtggttgctttgtcc
cagtactgtgtagagttgtggaatatagactcacgttcaaaggtggctgattgcagagga
catttaagttgggttcatggtgtgatgttttctcctgatggatcatcatttttgacatct
tctgatgaccagacaatcaggctctgggagacaaagaaagtatgtaagaactctgctgta
atgttaaagcaagaagtagatgttgtgtttcaagaaaatgaagtgatggtccttgcagtt
gaccatataaaacgtctgcaactcattaatggaaaaacaggtcagattgattatctgact
gaagctcaagttagctgctgttgcttaagtccacatcttcagtacattgcatttggagat
gaaaatggagccattgagattttagaacttgtaaacaatagaatcttccagtccaggttt
cagcacaagaaaactgtatggcacatccagttcacagctgatgagaagactcttatttca
agttctgatgattctgaaattcaggtatggaattggcaattggacaaatatatctttcta
cgaggccatcaggaaacagtgaaagactttagactcttgaaaaattcaagactgctctct
tggtcatttgatggaacagtgaaggtatggaatattattactggaaatacagaaaaagac
tttgtctgtcaccagggtacagtactttcttgtgacatttctcatgatgctaccaagttt
tcgtctacctctgctgacaagactgcaaagatctggagttttgatcaccttttgccactt
catgaattgaggggccacaacggctgtgtgcgctgctctgccttctctgtggacagtacc
ctactggcaaccggagatgacaatggagaaatcaggatatggaatgtctcaaacggtgag
cttcttcatttgtgtgctccgctttcagaagaaggagctgctacccatggaggctgggtg
actgacctttgcttttctccagatggcaaaatgcttatctctgctggaggatatattaag
tggtggaacgttgtcactggggaatcctcacagaccttctacacaaatggaaccaatctt
aagaaaatacatgtgtcccctgacttcaaaacatatgtgactgtggataatcttggtatt
ttatatattttacagactttagaataa

DBGET integrated database retrieval system