KEGG   Pongo abelii (Sumatran orangutan): 100459214
Entry
100459214         CDS       T01416                                 

Gene name
SLC7A6
Definition
(RefSeq) Y+L amino acid transporter 2
  KO
K13872  solute carrier family 7 (L-type amino acid transporter), member 6
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100459214 (SLC7A6)
Transporters [BR:pon02000]
 Solute carrier family (SLC)
  SLC7: Cationic amino acid transporter/glycoprotein-associated
   100459214 (SLC7A6)
SSDB
Motif
Pfam: AA_permease_2 AA_permease SirB
Other DBs
NCBI-GeneID: 100459214
NCBI-ProteinID: XP_009249123
Ensembl: ENSPPYG00000007486
UniProt: H2NRA9
LinkDB
Position
16
AA seq 515 aa
MEARQPGRPIPTYHLVPNTSQSQVEEDVSSPPQRSSETMQLKKEISLLNGVSLVVGNMIG
SGIFVSPKGVLVHTASYGMSLIVWAIGGLFSVVGALCYAELGTTITKSGASYAYILEAFG
GFIAFIRLWVSLLVVEPTSQAIIAITFANYIIQPSFPSCDPPYLACRLLAAACICLLTFV
NCAYVKWGTRVQDTFTYAKVVALIAIIVMGLVKLCQGHSEHFQDAFEGSSWDMGNLSLAL
YSALFSYSGWDTLNFVTEEIKNPERNLPLAIGISMPIVTLIYILTNVAYYTVLNISDVLS
SDAVAVTFADQTFGMFSWTIPIAVALSCFGGLNASIFASSRLFFVGSREGHLPDLLSMIH
IERFTPIPALLFNCTMALIYLIVEDVFQLINYFSFSYWFFVGLSVVGQLYLRWKEPKRPR
PLKLSMFFPIVFCICSVFLVIVPLFTDTINSLIGIGIALSGVPFYFMGVYLPESRRPLFI
RNVLAAITRGTQQLCFCVLTELDVAEEKEDERKTD
NT seq 1548 nt   +upstreamnt  +downstreamnt
atggaagccaggcagcctgggaggcccatacccacctaccatcttgtccctaacaccagc
cagtcccaggtggaagaagatgtcagctcgccacctcaaaggtcctccgaaactatgcag
ctgaagaaggagatctccctgctgaatggggtcagcctggtggtgggcaacatgatcggc
tcagggatctttgtctcacccaagggtgtgctggtacacactgcctcctatgggatgtcg
ctgattgtgtgggccattggtgggctcttctctgttgtgggtgccctttgttatgcagag
ctggggaccaccatcaccaagtcgggagccagctacgcttatattctagaggcctttggg
ggcttcattgccttcatccgcctgtgggtctcactgctagttgttgagcccaccagtcag
gccatcatcgccatcaccttcgccaactacatcatccagccgtccttccccagctgtgat
cccccatacctggcctgccgtctcctcgctgctgcttgcatatgtctgctgacatttgtg
aactgtgcctatgtcaagtggggcacacgtgtgcaggacacattcacttatgccaaggtc
gtagcactcattgccatcattgtcatgggccttgttaaactgtgccagggacactctgag
cactttcaggacgcctttgagggttcctcctgggacatgggaaacctctctcttgccctc
tactctgccctcttctcttactcaggttgggacacccttaattttgtaacagaagaaatc
aaaaacccagaaagaaatttgcccttggccattgggatttctatgccaattgtgacgctc
atctacatcctgaccaatgtggcctattacacagtgctgaacatttcagatgtccttagc
agtgatgccgtggctgtgacatttgctgaccagacgtttggcatgttcagctggaccatc
cccattgctgttgccctgtcctgctttgggggcctcaatgcatccatctttgcttcatca
aggttgttcttcgtgggctcccgggagggccacctaccggaccttctgtccatgatccac
attgagcgttttacacctatccctgctttactgttcaattgcaccatggcactcatctac
ctcatcgtggaggatgttttccagcttatcaactacttcagcttcagctactggttcttc
gtgggcctgtctgttgttggacagctctacctccgctggaaggagcccaagcggccccgg
cctctcaagctgagcatgtttttccccatcgtgttctgcatatgctccgtgtttctggtg
atagtgcccctcttcactgacaccattaattccctcattggcatcgggattgccctttct
ggagtccctttctacttcatgggtgtttacctgccagagtcccggaggccactgtttatt
cggaatgtcctggctgctatcaccagaggcacccagcagctttgcttttgtgtcctgact
gagcttgatgtagccgaagagaaagaggatgagaggaaaactgactag

DBGET integrated database retrieval system