KEGG   Pongo abelii (Sumatran orangutan): 100459280
Entry
100459280         CDS       T01416                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X2
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon01522  Endocrine resistance
pon04010  MAPK signaling pathway
pon04012  ErbB signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04066  HIF-1 signaling pathway
pon04068  FoxO signaling pathway
pon04072  Phospholipase D signaling pathway
pon04144  Endocytosis
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04520  Adherens junction
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon04912  GnRH signaling pathway
pon04915  Estrogen signaling pathway
pon04921  Oxytocin signaling pathway
pon04926  Relaxin signaling pathway
pon04928  Parathyroid hormone synthesis, secretion and action
pon04934  Cushing syndrome
pon05160  Hepatitis C
pon05163  Human cytomegalovirus infection
pon05165  Human papillomavirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05206  MicroRNAs in cancer
pon05210  Colorectal cancer
pon05212  Pancreatic cancer
pon05213  Endometrial cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05219  Bladder cancer
pon05223  Non-small cell lung cancer
pon05224  Breast cancer
pon05225  Hepatocellular carcinoma
pon05226  Gastric cancer
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459280 (EGFR)
   04012 ErbB signaling pathway
    100459280 (EGFR)
   04014 Ras signaling pathway
    100459280 (EGFR)
   04015 Rap1 signaling pathway
    100459280 (EGFR)
   04630 JAK-STAT signaling pathway
    100459280 (EGFR)
   04066 HIF-1 signaling pathway
    100459280 (EGFR)
   04068 FoxO signaling pathway
    100459280 (EGFR)
   04020 Calcium signaling pathway
    100459280 (EGFR)
   04072 Phospholipase D signaling pathway
    100459280 (EGFR)
   04151 PI3K-Akt signaling pathway
    100459280 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100459280 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100459280 (EGFR)
   04520 Adherens junction
    100459280 (EGFR)
   04540 Gap junction
    100459280 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459280 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100459280 (EGFR)
   04915 Estrogen signaling pathway
    100459280 (EGFR)
   04921 Oxytocin signaling pathway
    100459280 (EGFR)
   04926 Relaxin signaling pathway
    100459280 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100459280 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459280 (EGFR)
   05206 MicroRNAs in cancer
    100459280 (EGFR)
   05205 Proteoglycans in cancer
    100459280 (EGFR)
   05230 Central carbon metabolism in cancer
    100459280 (EGFR)
   05231 Choline metabolism in cancer
    100459280 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459280 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100459280 (EGFR)
   05212 Pancreatic cancer
    100459280 (EGFR)
   05225 Hepatocellular carcinoma
    100459280 (EGFR)
   05226 Gastric cancer
    100459280 (EGFR)
   05214 Glioma
    100459280 (EGFR)
   05218 Melanoma
    100459280 (EGFR)
   05219 Bladder cancer
    100459280 (EGFR)
   05215 Prostate cancer
    100459280 (EGFR)
   05213 Endometrial cancer
    100459280 (EGFR)
   05224 Breast cancer
    100459280 (EGFR)
   05223 Non-small cell lung cancer
    100459280 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100459280 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100459280 (EGFR)
   05171 Coronavirus disease - COVID-19
    100459280 (EGFR)
   05163 Human cytomegalovirus infection
    100459280 (EGFR)
   05165 Human papillomavirus infection
    100459280 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459280 (EGFR)
   01522 Endocrine resistance
    100459280 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100459280 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100459280 (EGFR)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100459280 (EGFR)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100459280 (EGFR)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100459280 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100459280 (EGFR)
  Exosomal proteins of bladder cancer cells
   100459280 (EGFR)
SSDB
Motif
Pfam: Recep_L_domain GF_recep_IV Furin-like
Other DBs
NCBI-GeneID: 100459280
NCBI-ProteinID: XP_002817983
LinkDB
Position
7
AA seq 628 aa
MRSSRTAGAALLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYVQRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALA
VLSNYDANKTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDF
QNHLGSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL
FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN
ILEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM
GENNTLVWKYADAGHVCHLCHPNCTYGS
NT seq 1887 nt   +upstreamnt  +downstreamnt
atgcgatcctcccggacggccggggcagcgctcctggcgctgctagctgcgctctgcccg
gcgagtcgggctctggaggaaaagaaagtttgccaaggcacgagtaacaagctcacgcag
ttgggcacttttgaagatcattttctcagcctccagaggatgttcaataactgtgaggtg
gtccttgggaatctggaaattacctatgtacagaggaattatgatctttccttcttaaag
accatccaggaggtggctggttatgtcctcatcgccctcaacacagtggagcggattcct
ttggaaaacctgcagatcatcagaggaaatatgtactatgaaaattcctatgccttagca
gtcttatctaactatgatgcaaataaaaccggactaaaggagctgcccatgagaaattta
caggaaatcctgcatggcgccgtgcggttcagcaacaaccctgccctgtgcaacgtggag
agcatccagtggcgggacatagtcagcagcgactttctcagcaacatgtcgatggacttc
cagaaccacctgggcagctgccaaaagtgtgatccaagctgtcccaatgggagctgctgg
ggtgcaggagaggagaactgccagaaactgaccaaaatcatctgtgcccagcagtgctct
gggcgctgccgcggcaaatcccccagtgactgctgccacaaccagtgtgccgctggctgc
acgggcccccgggagagcgactgcctggtctgccgcaaattccgagacgaagccacgtgc
aaggacacctgccccccactcatgctctacaaccccaccacataccagatggatgtgaac
cccgagggcaaatacagctttggtgccacctgcgtgaagaagtgtccccgtaattatgtg
gtgacagatcacggctcgtgcgtccgagcctgtggggccgacagctatgagatggaggaa
gacggcgtccgcaagtgtaagaagtgcgaagggccttgccgcaaagtgtgtaacggaata
ggtattggtgaatttaaagacacactctccataaatgctacgaatattaaacacttcaaa
aactgcacctccatcagtggcgatctccacatcctgccggtggcatttaggggtgactcc
ttcacacacactccacctctggatccacaggaactggatattctgaaaaccgtaaaggaa
atcacagggtttttgctgattcaggcttggcctgaaaacaggacggacctccatgctttt
gagaacctagaaatcatacgcggcaggaccaagcaacatgggcagttttctcttgcagtc
gtcagcctgaacataacatccttgggattacgctccctcaaggagataagcgatggagat
gtgataatttcaggaaacaaaaatttgtgctatgcaaatacaataaactggaaaaaactg
tttgggacctccggtcagaaaaccaaaattataagcaacagaggtgaaaacagctgcaag
gccacaggccaggtctgccatgccttgtgctcccccgagggctgctggggcccggagccc
agggactgcgtctcctgccggaatgtcagccgaggcagagaatgcgtggacaagtgcaac
attctggagggcgagccaagggagtttgtggagaactctgagtgcatacagtgccaccca
gaatgcctgccccaggccatgaacatcacctgcacgggacggggaccagacaactgtatc
cagtgtgcccactacattgacggcccccactgcgtcaagacctgcccggcaggagtcatg
ggagaaaacaacaccctggtctggaagtacgcagacgccggccacgtgtgccacctgtgc
catccaaactgcacctacgggtcctaa

DBGET integrated database retrieval system