KEGG   Pongo abelii (Sumatran orangutan): 100459445
Entry
100459445         CDS       T01416                                 

Definition
(RefSeq) NF-kappa-B inhibitor alpha
  KO
K04734  NF-kappa-B inhibitor alpha
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04024  cAMP signaling pathway
pon04062  Chemokine signaling pathway
pon04064  NF-kappa B signaling pathway
pon04210  Apoptosis
pon04380  Osteoclast differentiation
pon04620  Toll-like receptor signaling pathway
pon04621  NOD-like receptor signaling pathway
pon04622  RIG-I-like receptor signaling pathway
pon04623  Cytosolic DNA-sensing pathway
pon04625  C-type lectin receptor signaling pathway
pon04657  IL-17 signaling pathway
pon04658  Th1 and Th2 cell differentiation
pon04659  Th17 cell differentiation
pon04660  T cell receptor signaling pathway
pon04662  B cell receptor signaling pathway
pon04668  TNF signaling pathway
pon04722  Neurotrophin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04926  Relaxin signaling pathway
pon04931  Insulin resistance
pon05132  Salmonella infection
pon05134  Legionellosis
pon05135  Yersinia infection
pon05140  Leishmaniasis
pon05142  Chagas disease
pon05145  Toxoplasmosis
pon05160  Hepatitis C
pon05161  Hepatitis B
pon05162  Measles
pon05163  Human cytomegalovirus infection
pon05164  Influenza A
pon05166  Human T-cell leukemia virus 1 infection
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05168  Herpes simplex virus 1 infection
pon05169  Epstein-Barr virus infection
pon05170  Human immunodeficiency virus 1 infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
pon05203  Viral carcinogenesis
pon05215  Prostate cancer
pon05220  Chronic myeloid leukemia
pon05222  Small cell lung cancer
pon05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    100459445
   04668 TNF signaling pathway
    100459445
   04024 cAMP signaling pathway
    100459445
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100459445
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    100459445
   04621 NOD-like receptor signaling pathway
    100459445
   04622 RIG-I-like receptor signaling pathway
    100459445
   04623 Cytosolic DNA-sensing pathway
    100459445
   04625 C-type lectin receptor signaling pathway
    100459445
   04660 T cell receptor signaling pathway
    100459445
   04658 Th1 and Th2 cell differentiation
    100459445
   04659 Th17 cell differentiation
    100459445
   04657 IL-17 signaling pathway
    100459445
   04662 B cell receptor signaling pathway
    100459445
   04062 Chemokine signaling pathway
    100459445
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100459445
   04926 Relaxin signaling pathway
    100459445
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    100459445
  09158 Development and regeneration
   04380 Osteoclast differentiation
    100459445
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459445
   05203 Viral carcinogenesis
    100459445
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100459445
  09162 Cancer: specific types
   05220 Chronic myeloid leukemia
    100459445
   05215 Prostate cancer
    100459445
   05222 Small cell lung cancer
    100459445
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    100459445
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    100459445
   05135 Yersinia infection
    100459445
   05134 Legionellosis
    100459445
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    100459445
   05170 Human immunodeficiency virus 1 infection
    100459445
   05161 Hepatitis B
    100459445
   05160 Hepatitis C
    100459445
   05171 Coronavirus disease - COVID-19
    100459445
   05164 Influenza A
    100459445
   05162 Measles
    100459445
   05168 Herpes simplex virus 1 infection
    100459445
   05163 Human cytomegalovirus infection
    100459445
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459445
   05169 Epstein-Barr virus infection
    100459445
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    100459445
   05140 Leishmaniasis
    100459445
   05142 Chagas disease
    100459445
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100459445
   04131 Membrane trafficking [BR:pon04131]
    100459445
Transcription factors [BR:pon03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Ankyrin only
    100459445
Membrane trafficking [BR:pon04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    100459445
SSDB
Motif
Pfam: Ank Ank_2 Ank_3 Ank_5 Ank_4
Other DBs
NCBI-GeneID: 100459445
NCBI-ProteinID: XP_002824720
Ensembl: ENSPPYG00000005743
UniProt: H2NL11
LinkDB
Position
14
AA seq 317 aa
MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP
RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI
TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTQHLHSILKATN
YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG
ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE
DELPYDDCVFGGQRLTL
NT seq 954 nt   +upstreamnt  +downstreamnt
atgttccaggcggccgagcgcccccaggagtgggccatggagggcccccgcgacgggctg
aagaaggagcggctactggacgaccgccacgacagcggcctggactccatgaaggacgag
gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg
cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgttcctgcacttg
gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac
ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc
accaaccagccagaaattgctgaggcgcttctgggagctggctgtgatcctgagctccga
gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcctggccagtgtg
ggagtcctgactcagtcctgcaccacccagcacctccactccatcctgaaggctaccaac
tacaatggccacacgtgtctacacttagcctctatccatggctacctgggcatcgtggag
cttttggtgtccttgggtgcggatgtcaatgctcaggagccctgtaatggccggactgcc
cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg
gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc
ccaagcacccggatacagcagcagctgggccagctgacactagaaaaccttcagatgctg
ccagagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag
gacgagctgccctatgatgactgtgtgtttggaggccagcgtctgacgttatga

DBGET integrated database retrieval system