KEGG   Pongo abelii (Sumatran orangutan): 100459471
Entry
100459471         CDS       T01416                                 

Gene name
DNMT3A
Definition
(RefSeq) DNA (cytosine-5)-methyltransferase 3A isoform X1
  KO
K17398  DNA (cytosine-5)-methyltransferase 3A [EC:2.1.1.37]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00270  Cysteine and methionine metabolism
pon01100  Metabolic pathways
pon05206  MicroRNAs in cancer
Module
pon_M00035  Methionine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100459471 (DNMT3A)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    100459471 (DNMT3A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100459471 (DNMT3A)
   03032 DNA replication proteins [BR:pon03032]
    100459471 (DNMT3A)
   03036 Chromosome and associated proteins [BR:pon03036]
    100459471 (DNMT3A)
Enzymes [BR:pon01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.37  DNA (cytosine-5-)-methyltransferase
     100459471 (DNMT3A)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Zinc finger
   Cys4 GATA-factors
    100459471 (DNMT3A)
DNA replication proteins [BR:pon03032]
 Eukaryotic type
  DNA Replication Termination Factors
   DNA methylation enzymes
    100459471 (DNMT3A)
Chromosome and associated proteins [BR:pon03036]
 Eukaryotic type
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100459471 (DNMT3A)
SSDB
Motif
Pfam: ADD_DNMT3 DNA_methylase PWWP
Other DBs
NCBI-GeneID: 100459471
NCBI-ProteinID: XP_024098136
Ensembl: ENSPPYG00000012591
LinkDB
Position
2A
AA seq 909 aa
MPSSGPGDTSSSAAEREEDRKDGEEQEEPRGKEERQEPSTTARKVGRPGRKRKHPPVESS
DTPKDPAVISKSPSMAQDSGSSELLPNGDLEKRSEPQPEEGSPAGGQKGGAPAEGEGAAE
TLPEASRAVENGCCTPKEGRGAPAEAGKEQKETSIESMKMEGSRGRLRGGLGWESSLRQR
PMPRHTFQAGDPYYISKRKRDEWLARWKREAEKKAKVIAGMNAVEENQGPGESQKVEEAS
PPAVQQPTDPASPTVATTPEPVGSDAGDKNATKAGDDEPEYEDGRGFGIGELVWGKLRGF
SWWPGRIVSWWMTGRSRAAEGTRWVMWFGDGKFSVVCVEKLMPLSSFCSAFHQATYNKQP
MYRKAIYEVLQVASSRAGKLFPVCHDSDESDTAKAVEVQNKPMIEWALGGFQPSGPKGLE
PPEEEKNPYKEVYTDMWVEPEAAAYAPPPPAKKPRKSTAEKPKVKEIIDERTRERLVYEV
RQKCRNIEDICISCGSLNVTLEHPLFVGGMCQNCKNCFLECAYQYDDDGYQSYCTICCGG
REVLMCGNNNCCRCFCVECVDLLVGPGAAQAAIKEDPWNCYMCGHKGTYGLLRRREDWPS
RLQMFFANNHDQEFDPPKVYPPVPAEKRKPIRVLSLFDGIATGLLVLKDLGIQVDRYIAS
EVCEDSITVGMVRHQGKIMYVGDVRSVTQKHIQEWGPFDLVIGGSPCNDLSIVNPARKGL
YEGTGRLFFEFYRLLHDARPKEGDDRPFFWLFENVVAMGVSDKRDISRFLESNPVMIDAK
EVSAAHRARYFWGNLPGMNRPLASTVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQG
KDQHFPVFMNEKEDILWCTEMERVFGFPVHYTDVSNMSRLARQRLLGRSWSVPVIRHLFA
PLKEYFACV
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgccctccagcggccccggggacaccagcagctctgctgcggagcgggaggaggaccga
aaggacggagaggagcaggaggagccgcgtggcaaggaggagcgccaagagcccagcacc
acggcacggaaggtggggcggcctgggaggaagcgcaagcaccccccggtggaaagcagt
gacacgccaaaggaccctgcggtgatctccaagtccccatccatggcccaggactcaggc
tcctcagagctattacccaatggggacttggagaagcggagtgagccccagccagaggag
gggagccctgctggggggcagaagggcggggccccagcagagggagagggtgcagctgag
accctgcccgaagcctcaagagcagtggaaaatggctgctgcacccccaaggagggccga
ggagcccctgcagaagcgggcaaagaacagaaggagaccagcatcgaatccatgaaaatg
gagggctcccggggccggctgcggggtggcttgggctgggagtccagcctccgtcagcgg
cccatgccgaggcacaccttccaggcgggggacccctactacatcagcaagcgcaagcgg
gacgagtggctggcacgctggaaaagggaggctgagaagaaagccaaggtcattgcagga
atgaatgctgtggaagaaaaccaggggcccggggagtctcagaaggtggaggaggccagc
cctcctgctgtgcagcagcccactgaccccgcatcccccactgtggctaccacgcctgag
cccgtggggtccgatgccggggacaagaatgccaccaaagcaggcgatgacgagccagag
tacgaggacggccggggctttggcattggggagctggtgtgggggaaactgcggggcttc
tcctggtggccaggccgcattgtgtcttggtggatgacgggccggagccgagcagctgaa
ggcacccgctgggtcatgtggttcggagacggcaaattctcagtggtgtgtgttgagaag
ctgatgccgctgagctcgttttgcagtgcgttccaccaggccacgtacaacaagcagccc
atgtaccgcaaagccatctacgaggtcctgcaggtggccagcagccgcgcagggaagctg
ttccccgtgtgccacgacagcgatgagagtgacactgccaaggccgtggaggtgcagaac
aagcctatgattgaatgggccctggggggcttccagccctctggccctaagggcctggaa
ccaccagaagaagagaagaatccctacaaagaagtgtacacggacatgtgggtggaacct
gaagcagctgcctacgcaccacctccaccagccaaaaagccccggaagagcacagcggag
aagcccaaggtcaaggagattattgatgagcgcacaagagagcggctagtgtacgaggtg
cggcagaagtgccggaacattgaggacatctgcatctcctgtgggagcctcaatgtcacc
ctggaacaccccctcttcgttggaggaatgtgccaaaactgcaagaactgctttctggag
tgtgcgtaccagtacgacgacgacggctaccagtcctactgcaccatctgctgcgggggc
cgtgaggtgctcatgtgcggaaacaacaactgctgcaggtgcttttgcgtggagtgtgtg
gacctcttggtggggccgggggctgcccaggcagccattaaggaagacccctggaactgc
tacatgtgtgggcacaagggtacctacgggctgctgcggcggcgagaggactggccctcc
cggctccagatgttcttcgctaataaccacgaccaggaatttgaccctccaaaggtttac
ccacctgtcccagctgagaagaggaagcccatccgggtgctgtctctctttgatggaatt
gctacagggctcctggtgctgaaggacttgggcattcaggtggaccgctacattgcctcg
gaggtgtgtgaggactccatcacggtgggcatggtgcggcaccaggggaagatcatgtac
gtcggggacgtccgcagcgtcacacagaagcatatccaggagtggggcccattcgatctg
gtgattgggggcagtccctgcaatgacctctccatcgtcaaccctgctcgcaagggcctc
tacgagggcactggccggctcttctttgagttctaccgcctcctgcatgatgcgcggccc
aaggagggagatgatcgccccttcttctggctctttgagaatgtggtggccatgggcgtt
agtgacaagagggacatctcgcgatttctcgagtccaaccctgtgatgattgatgccaaa
gaagtgtcagctgcacacagggcccgctacttctggggtaaccttcccggtatgaacagg
ccgttggcatccactgtgaatgataagctggagctgcaggagtgtctggagcatggcagg
atagccaagttcagcaaagtgaggaccattactacgaggtcaaactccataaagcagggc
aaagaccagcattttcctgtcttcatgaatgagaaagaggacatcttatggtgcactgaa
atggaaagggtatttggtttcccagtccactatactgacgtctccaacatgagccgcttg
gcgaggcagagactgctgggccggtcatggagcgtgccagtcatccgccacctcttcgct
ccgctgaaggagtattttgcgtgtgtgtaa

DBGET integrated database retrieval system