KEGG   Pongo abelii (Sumatran orangutan): 100459702
Entry
100459702         CDS       T01416                                 

Gene name
IL6R
Definition
(RefSeq) interleukin-6 receptor subunit alpha isoform X1
  KO
K05055  interleukin 6 receptor
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04060  Cytokine-cytokine receptor interaction
pon04061  Viral protein interaction with cytokine and cytokine receptor
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon04659  Th17 cell differentiation
pon04932  Non-alcoholic fatty liver disease
pon05163  Human cytomegalovirus infection
pon05171  Coronavirus disease - COVID-19
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459702 (IL6R)
   04066 HIF-1 signaling pathway
    100459702 (IL6R)
   04151 PI3K-Akt signaling pathway
    100459702 (IL6R)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459702 (IL6R)
   04061 Viral protein interaction with cytokine and cytokine receptor
    100459702 (IL6R)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459702 (IL6R)
   04659 Th17 cell differentiation
    100459702 (IL6R)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459702 (IL6R)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease
    100459702 (IL6R)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    100459702 (IL6R)
   05163 Human cytomegalovirus infection
    100459702 (IL6R)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459702 (IL6R)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:pon04050]
    100459702 (IL6R)
   04090 CD molecules [BR:pon04090]
    100459702 (IL6R)
Cytokine receptors [BR:pon04050]
 Interleukin receptor families
  IL6/12 receptor family
   100459702 (IL6R)
CD molecules [BR:pon04090]
 Proteins
  100459702 (IL6R)
SSDB
Motif
Pfam: IL6Ra-bind ig Ig_3 Ig_2 fn3 I-set Ig_5
Other DBs
NCBI-GeneID: 100459702
NCBI-ProteinID: XP_024090051
Ensembl: ENSPPYG00000000781
LinkDB
Position
1
AA seq 484 aa
MLAVGCALLAALLAAPGEALAPGRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHW
VLRKPAAGSHSSRWAGMGRRLLLRSVQLHDSGNYSCYQAGRPAGTVHLLVDVPPEEPQLS
CFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSWESQKFSCQLAV
PEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQD
PHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQ
GEWSEWSPEAMGTPWTGFSPQTIPGGIWDPAGESRSPPAENEVSTPMQALTTNKDDDNIL
VRDSANATSLPVQDSSSVPLPTFLVAGGSLAFGTLLCVAIVLRFKKTWKLRALKEGKTSI
HPPYSLGQLVPERPRPTPVLVPLISPPVSPSSLGSDNTSSHNRPDARDPRSPYDISNTDY
FFPR
NT seq 1455 nt   +upstreamnt  +downstreamnt
atgctggccgtcggctgcgcgctgctggctgccctgctcgccgcgccgggagaggcgctg
gccccagggcgctgccctgcgcaggaggtggcgagaggtgtgctgaccagtctgccagga
gacagcgtgactctgacctgcccaggggtagagccggaagacaatgccactgttcactgg
gtgctcaggaagccggctgcaggctcccattctagcagatgggctggcatgggaaggagg
ctgctgctgaggtcggtgcagctccatgactctggaaactattcatgctaccaggccggc
cgcccagctgggactgtgcacttgctggtggatgttccccccgaggagccccagctctcc
tgcttccggaagagccccctcagcaacgttgtttgtgagtggggtcctcggagcacccca
tccctgacgaccaaggctgtgctgttggtgaggaagtttcagaacagtccggccgaagac
ttccaggagccgtgccagtattcctgggagtcccagaagttctcctgccagttggcagtc
ccggagggagacagctctttctacatagtgtccatgtgcgttgccagtagtgtcgggagc
aagttcagcaaaactcaaacctttcagggttgtggaatcttgcagcctgatccgcctgcc
aacatcacagtcactgccgtggccagaaacccccgctggctcagtgtcacctggcaagac
ccccactcctggaactcatctttctacagactacggtttgagctcagatatcgggctgaa
cggtcaaagacattcacaacatggatggtcaaggacctccagcatcactgtgtcatccac
gacgcctggagcggcctgaggcacgtggtgcagcttcgtgcccaggaggagttcgggcaa
ggcgagtggagcgagtggagcccggaggccatgggcacaccttggacaggcttctctcca
cagaccatcccgggtggcatttgggacccagctggagaatccaggagtcctccagctgag
aacgaggtgtccacccccatgcaggcacttactactaataaagacgatgataatattctc
gtcagagattctgcaaatgcgacaagcctcccagtgcaagattcttcttcggtaccactg
cccacattcctggttgctggagggagcctggccttcggaacgctcctctgcgttgccatt
gttctgaggttcaagaagacgtggaagctgcgggctctgaaggaaggcaagacaagcata
cacccgccgtactctttggggcagctggtcccggagaggcctcgacccaccccagtgctt
gttcctctcatctccccaccggtgtcccccagcagcctggggtctgacaatacctcgagc
cacaaccgaccagatgccagggacccacggagcccttatgacatcagcaatacagactac
ttcttccccagatag

DBGET integrated database retrieval system