KEGG   Pongo abelii (Sumatran orangutan): 100459751
Entry
100459751         CDS       T01416                                 

Gene name
FGF2
Definition
(RefSeq) fibroblast growth factor 2
  KO
K18497  fibroblast growth factor 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04550  Signaling pathways regulating pluripotency of stem cells
pon04810  Regulation of actin cytoskeleton
pon05167  Kaposi sarcoma-associated herpesvirus infection
pon05200  Pathways in cancer
pon05205  Proteoglycans in cancer
pon05218  Melanoma
pon05224  Breast cancer
pon05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100459751 (FGF2)
   04014 Ras signaling pathway
    100459751 (FGF2)
   04015 Rap1 signaling pathway
    100459751 (FGF2)
   04020 Calcium signaling pathway
    100459751 (FGF2)
   04151 PI3K-Akt signaling pathway
    100459751 (FGF2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    100459751 (FGF2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100459751 (FGF2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459751 (FGF2)
   05205 Proteoglycans in cancer
    100459751 (FGF2)
  09162 Cancer: specific types
   05226 Gastric cancer
    100459751 (FGF2)
   05218 Melanoma
    100459751 (FGF2)
   05224 Breast cancer
    100459751 (FGF2)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    100459751 (FGF2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100459751 (FGF2)
Cytokines and growth factors [BR:pon04052]
 Growth factors
  Growth factors (RTK binding)
   100459751 (FGF2)
Glycosaminoglycan binding proteins [BR:pon00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   100459751 (FGF2)
SSDB
Motif
Pfam: FGF IL1 Fascin
Other DBs
NCBI-GeneID: 100459751
NCBI-ProteinID: XP_002815172
Ensembl: ENSPPYG00000015046
LinkDB
Position
4
AA seq 345 aa
MAMVASSHAWFMKVQRLVLLCDEQGNTGGEDLVSTTKEQSAPKGAARRREESWGHGRLVG
VGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRHPSVNPSSRAAGSP
RTRGRRTEERPSRSRLGDRGRGRALPGGRLGGRGRGRAPERVGGRGRGRGTAAPRAAPAA
RGPRPGPAGTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVD
GVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESN
NYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
NT seq 1038 nt   +upstreamnt  +downstreamnt
atggctatggttgcaagctctcatgcatggttcatgaaagtccagagactggttcttctt
tgtgacgagcagggcaacactggtggtgaggacttggtttccacaaccaaggagcagtct
gccccaaagggggcggcgcgcaggagggaggagagctgggggcacgggaggctggtgggt
gtcgggggtggagatgtagaagatgtgacgccgcggcccggcgggtgccagattagcgga
cgcggtgcccgcggttgcaacgggatcccgggcgctgcagcttgggaggcggctctcccc
aggcggcgtccgcggagacacccatccgtgaaccccagctcccgggccgccggctcgccg
cgcaccaggggccggcggacagaagagcggccgagccgctcgaggctgggggaccgcggg
cgcggccgcgcgctgccgggcgggaggctggggggccggggccggggccgtgccccggag
cgggtcggaggccggggccggggccgggggacggcggctccccgcgcggctccagcagct
cggggaccccggccgggccccgcagggaccatggcagccgggagcatcaccacgctgccc
gccttgcccgaggatggcggcagcggcgccttcccgcccggccacttcaaggaccccaag
cggctgtactgcaaaaacgggggcttcttcctgcgcatccaccccgacggccgagttgac
ggggtccgagagaagagcgaccctcacatcaaactacaacttcaagcagaagaaagagga
gttgtgtctatcaaaggagtgtgtgctaaccgctaccttgctatgaaggaagatggaaga
ttactggcttctaaatgtgttacggatgagtgtttcttttttgaacgattggaatctaat
aactacaatacttaccggtcaaggaaatacaccagttggtatgtggcactgaaacgaact
gggcagtataaacttggatccaaaacaggacctgggcagaaagctatactttttcttcca
atgtctgctaagagctga

DBGET integrated database retrieval system