KEGG   Pongo abelii (Sumatran orangutan): 100459890
Entry
100459890         CDS       T01416                                 

Gene name
EPO
Definition
(RefSeq) erythropoietin isoform X1
  KO
K05437  erythropoietin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04060  Cytokine-cytokine receptor interaction
pon04066  HIF-1 signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04630  JAK-STAT signaling pathway
pon04640  Hematopoietic cell lineage
pon05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    100459890 (EPO)
   04066 HIF-1 signaling pathway
    100459890 (EPO)
   04151 PI3K-Akt signaling pathway
    100459890 (EPO)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100459890 (EPO)
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    100459890 (EPO)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100459890 (EPO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:pon04052]
    100459890 (EPO)
Cytokines and growth factors [BR:pon04052]
 Cytokines
  CSF and other factors
   100459890 (EPO)
SSDB
Motif
Pfam: EPO_TPO
Other DBs
NCBI-GeneID: 100459890
NCBI-ProteinID: XP_024105759
LinkDB
Position
7
AA seq 193 aa
MGVHECPAWLWLLLSLLSLPLGLPVLGAPPRLICDSRVLERYLLEAKEAENVTTGCAEHC
SLSENITVPDTKVNFYAWKRMEVGQQALEVWQGLALLSEAVLRGQALLVNSSQPWEPLQL
HVDKAVSGLRSLTTLLRALGAQKEANSPPDAALAAPLRTITADTFRKFFRVYSNFLRGKL
KLYTEEACRTGDR
NT seq 582 nt   +upstreamnt  +downstreamnt
atgggggtgcacgaatgtcctgcctggctgtggcttctcctatccctgctgtcgctccct
ctgggcctcccagtcctgggcgccccaccacgcctcatctgtgacagccgagtcctggag
aggtacctcttggaggccaaggaggccgagaatgtcacgacgggctgtgccgaacactgc
agcttgagtgagaatatcaccgtcccagacaccaaagttaacttctatgcctggaagagg
atggaggtcgggcagcaggccttagaagtctggcagggcctggccctgctctcggaagct
gtcctgcggggccaggccctgttggtcaactcttcccagccgtgggagcccctgcagctg
cacgtggataaagctgtcagtggccttcgcagcctcaccactctgcttcgggcgctggga
gcccagaaggaagccaactcccctccagatgcggccttggctgctccactccgaacaatc
actgctgacactttccgcaaattcttccgagtctactccaatttcctccggggaaagctg
aagctgtacacagaggaggcctgcaggacaggggacagatga

DBGET integrated database retrieval system