KEGG   Pongo abelii (Sumatran orangutan): 100459983
Entry
100459983         CDS       T01416                                 

Gene name
ETV5
Definition
(RefSeq) ETS translocation variant 5 isoform X1
  KO
K15593  ets translocation variant 5
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon05202  Transcriptional misregulation in cancer
pon05215  Prostate cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    100459983 (ETV5)
  09162 Cancer: specific types
   05215 Prostate cancer
    100459983 (ETV5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:pon03000]
    100459983 (ETV5)
Transcription factors [BR:pon03000]
 Eukaryotic type
  Helix-turn-helix
   Tryptophan clusters Ets-type
    100459983 (ETV5)
SSDB
Motif
Pfam: ETS_PEA3_N Ets HSF_DNA-bind
Other DBs
NCBI-GeneID: 100459983
NCBI-ProteinID: XP_002814421
Ensembl: ENSPPYG00000014376
LinkDB
Position
3
AA seq 552 aa
MSERRCPPEHREGVNDTGGSLFPQKLLNAETSQSGIKDAESTMDGFYDQQVPFMVPGKSR
SEECRGRPVIDRKRKFLDTDLAHDSEELFQDLSQLQEAWLAEAQVPDDEQFVPDFQSDNL
VLHASPPTKIKRELHSPSSELSSCSHEQALGANYGEKCLYNYCAYDRKPPSGFKPLTPPT
TPLSPTHQNPLFPPPQATLPTSAHAPAAGPVQGVGPAPAPHSLPEPGPQQQTFAVPRPPH
QPLQMPKMMPENQYPSEQRFQRQLSEPCHPFPPQPGVPGDNRPSYHRQMSEPIVPAAPPP
PQGFKQEYHDPLYEHGVPGMPAPPAHRFQSPMGIKQEPRDYCVDSEVPNCQSSYMRGGYF
SSSHEGFSYEKDPRLYFDDTCVVPERLEGKVKQEPTMYREGPPYQRRGSLQLWQFLVTLL
DDPANAHFIAWTGRGMEFKLIEPEEVARRWGIQKNRPAMNYDKLSRSLRYYYEKGIMQKV
AGERYVYKFVCDPDALFSMAFPDNQRPFLKAESECHLSEEDTLPLTHFEDSPAYLLDMDR
CSSLPYAEGFAY
NT seq 1659 nt   +upstreamnt  +downstreamnt
atgtctgagaggcgctgccccccagagcaccgggagggggtaaatgacacaggaggatcc
cttttcccccagaaattactcaatgctgaaacctctcaaagtggtattaaagacgctgaa
agcaccatggatgggttttatgatcagcaagtcccttttatggtcccagggaaatctcga
tctgaggaatgtagagggcggcctgtgattgacagaaagaggaagtttttggacacagat
ctggctcacgattctgaagagctgtttcaggatctcagtcaacttcaagaggcttggtta
gctgaagcacaagttcctgatgatgaacagtttgtcccagattttcagtctgataacttg
gtgcttcatgcctcacctccaaccaagatcaaacgggagctgcacagcccctcctctgag
ctgtcgtcttgtagccatgagcaggctctcggtgctaactatggagaaaagtgcctctac
aactattgtgcctatgataggaagcctccctctgggttcaagccattaacccctcctaca
acccccctctcacccacccatcagaatcccctatttcccccacctcaggcaactctgccc
acctcagcgcacgcccctgcagctggcccagttcaaggtgtgggccccgcccccgccccc
cattcgcttccagagcctggaccacagcagcaaacatttgcggtcccccgaccaccacat
cagcccctgcagatgccaaagatgatgcctgaaaaccagtatccatcagaacagagattt
cagagacaactgtctgaaccctgccaccccttccctcctcagccaggagttcctggagat
aatcgccccagttaccatcggcaaatgtcagaacctattgtccctgcagctcccccgccc
cctcagggattcaagcaagaataccatgacccgctctatgaacacggggtcccgggcatg
ccagcgcccccagcacacaggttccagtcaccaatgggaatcaagcaggagcctcgggat
tactgcgtcgattcagaagtgcctaactgccagtcatcctacatgagagggggttatttc
tccagcagccatgaaggattttcatatgaaaaagatccccgattatactttgacgacact
tgtgttgtgcctgagagactggaaggcaaagtcaaacaggagcctaccatgtatcgagag
gggcccccttaccagagacgaggttcccttcagctatggcagttcctggtcacccttctt
gatgacccagccaatgctcacttcattgcctggacaggccgaggcatggagttcaagctg
atagaaccggaagaggttgctcggcgctggggcatccagaagaaccggccagccatgaac
tatgacaagctgagccgctctctccgctattactatgaaaagggcatcatgcagaaggtg
gctggagagcgatacgtctacaaatttgtctgtgacccagatgccctcttctccatggct
ttcccggataaccagcgtccgttcctgaaggcagagtccgagtgtcacctcagcgaggag
gacaccctgccactgacccactttgaagacagccccgcttacctcctggacatggaccgc
tgcagcagcctcccctatgccgaaggctttgcttactaa

DBGET integrated database retrieval system