KEGG   Pongo abelii (Sumatran orangutan): 100460001
Entry
100460001         CDS       T01416                                 

Gene name
PDGFRB
Definition
(RefSeq) platelet-derived growth factor receptor beta isoform X1
  KO
K05089  platelet-derived growth factor receptor beta [EC:2.7.10.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon01521  EGFR tyrosine kinase inhibitor resistance
pon04010  MAPK signaling pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04020  Calcium signaling pathway
pon04072  Phospholipase D signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04510  Focal adhesion
pon04540  Gap junction
pon04630  JAK-STAT signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05165  Human papillomavirus infection
pon05200  Pathways in cancer
pon05206  MicroRNAs in cancer
pon05214  Glioma
pon05215  Prostate cancer
pon05218  Melanoma
pon05230  Central carbon metabolism in cancer
pon05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100460001 (PDGFRB)
   04014 Ras signaling pathway
    100460001 (PDGFRB)
   04015 Rap1 signaling pathway
    100460001 (PDGFRB)
   04630 JAK-STAT signaling pathway
    100460001 (PDGFRB)
   04020 Calcium signaling pathway
    100460001 (PDGFRB)
   04072 Phospholipase D signaling pathway
    100460001 (PDGFRB)
   04151 PI3K-Akt signaling pathway
    100460001 (PDGFRB)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100460001 (PDGFRB)
   04540 Gap junction
    100460001 (PDGFRB)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100460001 (PDGFRB)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100460001 (PDGFRB)
   05206 MicroRNAs in cancer
    100460001 (PDGFRB)
   05230 Central carbon metabolism in cancer
    100460001 (PDGFRB)
   05231 Choline metabolism in cancer
    100460001 (PDGFRB)
  09162 Cancer: specific types
   05214 Glioma
    100460001 (PDGFRB)
   05218 Melanoma
    100460001 (PDGFRB)
   05215 Prostate cancer
    100460001 (PDGFRB)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    100460001 (PDGFRB)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100460001 (PDGFRB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460001 (PDGFRB)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:pon04090]
    100460001 (PDGFRB)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100460001 (PDGFRB)
Protein kinases [BR:pon01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   100460001 (PDGFRB)
CD molecules [BR:pon04090]
 Proteins
  100460001 (PDGFRB)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr Pkinase ig Ig_3 I-set Ig_2 V-set C1-set Ig_6 TrmE_N
Other DBs
NCBI-GeneID: 100460001
NCBI-ProteinID: XP_002816120
Ensembl: ENSPPYG00000015943
UniProt: A0A663D6Y7 H2PH25
LinkDB
Position
5
AA seq 1106 aa
MRLLGAMPALALKGQLLLLPLLLLLEPQVSQGLVITPPGPELVLNVSSTFVLTCSGSAPV
VWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLEPDERKRLYIFV
PDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDIALPVPYDHQRGFS
GIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGN
EVVNFEWTYPRKESGRLVEPVTDFLLDMPYHIRSILHIPSAELEDSGTYTCNVTESVNDH
QDEKAINITVVESGYVRLLGEVGTLQFAELHRSRTLQVVFEAYPPPTVLWFKDNRTLGDS
SAGEIALSTRNVSETRYVSELTLVRVKVAEAGHYTMRAFHEDAEVQLSFQLQINVPVRVL
ELSESHPDSGEQTVRCRGRGMPQPNIIWSACRDLKRCPRELPPTLLGNSSEEESQLETNV
TYWEEEQEFEVVSTLRLQHVDRPLSVRCTLRNAVGQDTQEVIVVPHSLPFKVVVISAILA
LVVLTIISLIILIMLWQKKPRYEIRWKVIESVSSDGHEYIYVDPMQLPYDSTWELPRDQL
VLGRTLGSGAFGQVVEATAHGLSHSQATMKVAVKMLKSTARSSEKQALMSELKIMSHLGP
HLNVVNLLGACTKGGPIYIITEYCRYGDLVDYLHRNKHTFLQHHSDKRRPPSAELYSNAL
PVGLPLPSHVSLTGESDGGYMDMSKDESVDYVPMLDMKGDVKYADIESSNYMAPYDNYVP
SAPERTCRATLINESPVLSYMDLVGFSYQVANGMEFLASKNCVHRDLAARNVLICEGKLV
KICDFGLARDIMRDSNYISKGSTFLPLKWMAPESIFNSLYTTLSDVWSFGILLWEIFTLG
GTPYPELPMNEQFYNAIKRGYRMAQPAHASDEIYEIMQKCWEEKFEIRPPFSQLVLLLER
LLGEGYKKKYQQVDEEFLRSDHPAILRSQARLPGFHGLRSPLDTSSVLYTAVQPNEGDND
YIIPLPDPKPEVADEGPLEGSPSLASSTLNEVNTSSTISCDSPLEPQDEPEPEPQLELQV
EPEPELEQLPDSGCPAPRVEAEDSFL
NT seq 3321 nt   +upstreamnt  +downstreamnt
atgcggcttctgggtgcgatgccagctctggccctcaaaggccagctgctgttgctgccc
ctcctgttactgctggaaccacaggtctctcagggcctggtcatcacacccccagggcca
gagcttgtcctcaatgtctccagcaccttcgttctgacctgctctggttcagctccggtg
gtgtgggaacggatgtcccaggagcccccacaggaaatggccaaggcccaggatggcacc
ttctccagcgtgctgacactgaccaacctcactgggctagacacgggagaatacttttgc
acccacaatgactcccgtggactggagcctgatgagcggaaacggctctacatctttgtg
ccagatcccactgtgggcttcctccctaatgatgccgaggaactattcatctttctcacg
gaaataactgagatcaccattccatgccgagtaacagacccacagctggtggtgacactg
cacgagaagaaaggggacattgcactgcctgtcccctatgatcaccaacgtggcttttct
ggtatctttgaggacagaagctacatctgcaaaaccaccattggggacagggaggtggat
tccgatgcctactatgtctacagactccaggtgtcatctatcaacgtctctgtgaacgca
gtgcagactgtggtccgccagggtgagaacatcaccctcatgtgcattgtgatcgggaat
gaggtggtcaacttcgagtggacatacccccgcaaagaaagtgggcggctggtggagccg
gtgaccgacttcctcttggatatgccttaccacatccgctccatcctgcacatccccagt
gccgagttagaagactcggggacctacacctgcaatgtgacggagagtgtgaatgaccat
caggatgaaaaggccatcaacatcaccgtggttgagagtggctacgtgcggctcctggga
gaagtgggcacactgcaatttgctgagctgcatcggagccggacactgcaggtagtattc
gaggcctacccaccgcccaccgtcctgtggtttaaagacaaccgcaccctgggcgactcc
agcgctggcgagatcgccctgtccacgcgcaacgtgtcggagacccggtatgtgtcagag
ctgacactggttcgcgtgaaggtggcagaggctggccactacaccatgcgggccttccat
gaggacgctgaggtccagctctccttccagctacagatcaatgtccctgtccgagtgctg
gagctaagtgagagccaccctgacagcggggaacagacagtccgctgtcgtggccggggc
atgccccagccgaacatcatctggtccgcctgcagagacctcaaaaggtgtccacgcgag
ctgccgcccacgctgctggggaacagttccgaagaggagagccagctggagacgaacgtg
acgtactgggaggaggagcaggagtttgaggtggtgagcacactgcgtctgcagcacgtg
gatcggccgctgtcggtgcgctgcacgctgcgcaacgctgtgggccaggacacgcaggag
gtcatcgtggtgccacactccttgccctttaaggtggtggtgatctcagccatcctggcc
ctggtggtgctcaccatcatctcccttatcatcctcatcatgctttggcagaagaagcca
cgttacgagatccgatggaaggtgattgagtctgtgagctctgacggccatgagtacatc
tacgtggaccccatgcagctgccctatgactccacgtgggagctgccgcgggaccagctt
gtgctgggacgcaccctcggctctggggcctttgggcaggtggtggaggccacggctcat
ggcctgagccattctcaggccacgatgaaagtggccgtcaagatgcttaaatccacagcc
cgcagcagtgagaagcaagcccttatgtcggagctgaagatcatgagtcaccttgggccc
cacctgaacgtggtcaacctgttgggggcctgcaccaaaggaggacccatctatatcatc
actgagtactgccgctacggagacctggtggactacctgcaccgcaacaaacacaccttc
ctgcagcaccactctgacaagcgccgcccgcccagcgcggagctctacagcaatgcactg
cccgttgggctccccctgcccagccatgtgtccttgactggggagagcgacggtggctac
atggacatgagcaaggacgagtcggtggactacgtacccatgctggacatgaaaggagac
gtcaaatatgcagacatcgagtcctccaattacatggccccttacgataactacgttccc
tctgcccctgagaggacctgtcgggcaactttgatcaacgagtctccagtgctaagctac
atggacctcgtgggcttcagctaccaggtggccaatggcatggagtttctggcctccaag
aactgcgtccacagagacctggcggctaggaacgtgctcatctgtgaaggcaagctggtc
aagatctgtgactttggcctggctcgagacatcatgcgggactcgaattacatctccaaa
ggcagcacctttttgcctttgaagtggatggctccggagagcatcttcaacagcctctac
accaccctgagcgacgtgtggtccttcgggatcctgctctgggagatcttcaccttgggt
ggcaccccttacccagagctgcccatgaatgaacagttctacaatgccatcaaacggggt
taccgcatggcccagcctgcccatgcctccgatgagatctatgagatcatgcagaagtgc
tgggaagagaagtttgagattcggccccccttctcccagctggtgctgcttctcgagaga
ctgttgggcgaaggttacaaaaagaagtaccagcaggtggatgaggagtttctgaggagt
gaccacccagccatccttcggtcccaggcccgcttgcctgggttccatggcctccgatct
cccctggacaccagctccgtcctctatactgccgtgcagcccaatgagggtgacaacgac
tatatcatccccctgcccgaccccaaacccgaggttgctgacgagggcccactggagggt
tcccccagcctagccagctccaccctgaatgaagtcaacacctcctcaaccatctcctgt
gacagccccctggagccccaggatgaaccagagccagagccccagcttgagctccaggtg
gagccagagccggagctggaacagctgccggattcagggtgccctgcgcctcgggtggaa
gcagaggacagcttcctgtag

DBGET integrated database retrieval system