KEGG   Pongo abelii (Sumatran orangutan): 100460020
Entry
100460020         CDS       T01416                                 

Gene name
AFDN
Definition
(RefSeq) afadin isoform X1
  KO
K05702  afadin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04014  Ras signaling pathway
pon04015  Rap1 signaling pathway
pon04024  cAMP signaling pathway
pon04520  Adherens junction
pon04530  Tight junction
pon04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100460020 (AFDN)
   04015 Rap1 signaling pathway
    100460020 (AFDN)
   04024 cAMP signaling pathway
    100460020 (AFDN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    100460020 (AFDN)
   04530 Tight junction
    100460020 (AFDN)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    100460020 (AFDN)
SSDB
Motif
Pfam: RA DIL PDZ PDZ_6 FHA PDZ_2 Yop-YscD_cpl
Other DBs
NCBI-GeneID: 100460020
NCBI-ProteinID: XP_024104111
Ensembl: ENSPPYG00000017176
LinkDB
Position
6
AA seq 1892 aa
MSAGGRDEERRKLADIIHHWNANRLDLFEISQPTEDLEFHGVMRFYFQDKAAGNFATKCI
RVSSTATTQDVIETLAEKFRPDMRMLSSPKYSLYEVHVSGEERRLDIDEKPLVVQLNWNK
DDREGRFVLKNENDAIPPKKAQSNGPEKQEKEGVIQNFKRTLSKKEKKEKKKREKEALRQ
ASDKDDRPFQGEDVENSRLAAEVYKDMPETSFTRTISNPEVVMKRRRQQKLEKRMQEFRS
SDGRPDSGGTLRIYADSLKPNIPYKTILLSTTDPADFAVAEALEKYGLEKENPKDYCIAR
VMLPPGAQHSDEKGAKEIILDDDECPLQIFREWPSDKGILVFQLKRRPPDHIPKKTKKHL
EGKTPKGKERADGSGYGSTLPPEKLPYLVELSPDGSDSRDKPKLYRLQLSVTEVGTEKLD
DNSIQLFGPGIQPHHCDLTNMDGVVTVTPRSMDAETYVEGQRISETTMLQSGMKVQFGAS
HVFKFVDPSQDHALAKRSVDGGLMVKGPRHKPGIVQETTFDLGGDIHSETALPTSKSTTR
LDSDRVSSASSTAERGMVKPMIRVEQQPDYHRQESRMQDASGPELILPASIEFRESSEDS
FLSAIINYTNSSTVHFKLSPTYVLYMACRYVLSNQYRPDISPTERTHKVIAVVNKMVSMM
EGVIQEVDQVDQKQKNIAGALAFWMANASELLNFIKQDRDLSRITLDAQDVLAHLVQMAF
KYLVHCLQSELNNYMPAFLDDPEENSLQRPKIDDVLHTLTGAMSLLRRCRVNAALTIQLF
SQLFHFINMWLFNRLVTDPDSGLCSHYWGAIIRQQLGHIEAWAEKQGLELAADCHLSRIV
QATTLLTMDKYAPDDIPNINSTCFKLNSLQLQALLQNYHCAPDEPFIPTDLIENVVAVAE
NTADELARSDGREVQLEEDPDLQLPFLLPEDGYSCDVVRNIPNGLQEFLDPLCQRGFCRL
IPHTRSPGTWTIYFEGADYESHLLRENTELAQPLRKEPEIITVTLKKQNGMGLSIVAAKG
AGQDKLGIYVKSVVKGGAADVDGRLAAGDQLLSVDGRSLVGLSQERAAELMTRTSSVVTL
EVAKQGAIYHGLATLLNQPSPMMQRISDRRGSGKPRPKSEGFELYNNSTQNGSPESPQLP
WAEYSEPKKLPGDDRLMKNRADHRSSPNVANQPPSPGGKSAYAPGTTAKITSVSTGNLCT
EEQTPPPRPEAYPIPTQTYTREYFTFPASKSQDRMAPPQNQWPNYEEKPHVHTDSNHSSI
AIQRVTRSQEELREDKAYQLERHRIEAAMDRKSDSDMWINQSSSLDSSTSSQEHLNHSSK
SVTPASTLTKSGPGRWKTPAAIPATPVAVSQPIRTDLPPPPPPPPAHYAGDFDGMSMDLP
LPPPPSANQIGLPSAQVAAAERKKREEHQRWYEKEKARLEEERERKRREQERKLGQMRTQ
SLNPAPFSPLTAQQMKPEKPSTLQRPQETVIRELQPQQQPRTIERRDLQYITVSKEELSS
GDSLSPDPWKRDAKEKLEKQQQMHIVDMLSKEIQELQSKPDRSAEESDRLRKLMLEWQFQ
KRLQESKQKDEDDEEEEDDDVDTMLIMQRLEAERRARLQDEERRRQQQLEEMRKREAEDR
ARQEEERRRQEEERTKRDAEEKRRQEEGYYSRLEAERRRQHDEAARRLLEPEAPGLCRPP
LPRDYEPPSPSPAPGAPPPPPQRNASYLKTQVLSPDSLFTAKFVAYNEEEEEEDCSLAGQ
DKYSSTRKSHGDLLPAPLKPRPPPCQPRPASDGIFLSNSFQLPSAKANSTAHKKGQPSPP
PKKSSSYHPSHCKGPNSYPGSTGAAVGAHDAYRDAKEKRSKSQDADSPGSSGAPENLTFK
ERQRLFSQGQDVSNKVKASRKLTELENELNTK
NT seq 5679 nt   +upstreamnt  +downstreamnt
atgtcggcgggcggccgtgacgaggagcggcggaagctggccgacatcatccaccactgg
aacgccaaccggctggacctgttcgagatcagccagccgaccgaggatttggagttccat
ggagtgatgagattttattttcaagataaagctgctggaaactttgcaacaaaatgtatt
cgggtctctagtactgccaccactcaagatgtaatcgaaacgcttgcggagaaatttcga
cctgatatgcgaatgctgtcctctcccaagtattcactctatgaagtgcatgtcagcgga
gaagaaagaagattggatatagatgagaaacctctagttgtacaactgaattggaacaaa
gatgatcgggaaggcagatttgttcttaagaatgagaatgacgccattcctcctaagaag
gctcaaagtaatggacctgaaaagcaggaaaaagaaggggttatccagaacttcaagaga
actctctcaaagaaagaaaagaaggaaaaaaagaagagagaaaaagaggcattgcgacag
gcatctgataaagatgatagacctttccaaggggaggacgttgaaaattctcgactggct
gctgaggtttacaaagacatgcctgaaaccagctttactcgaaccatttctaatcctgag
gtggttatgaaacgacggaggcagcaaaaattggaaaagagaatgcaggaatttcggagc
tcagatgggcggcctgattcaggtggaacattgagaatttatgcagatagtttaaaacca
aatattccctacaagacaatcctgctgtctactacagatcctgcagactttgctgtggct
gaagctttagagaagtatggtctggaaaaagaaaaccctaaggattattgcatcgcccgg
gttatgcttcctcctggagcccagcattctgatgaaaagggtgctaaagaaattattctt
gatgatgatgagtgtcctttacaaatcttcagggaatggccgagtgacaaagggatttta
gtctttcagttgaagaggaggccaccagaccacatcccaaagaaaaccaagaaacacttg
gaaggcaagacacccaagggaaaggagagagctgacgggtctggctatggctccaccctt
cctccggagaagctgccctatttagtagagttaagcccagatggttctgactctagagat
aagccaaagctttaccgccttcagttaagtgttactgaagttgggacagaaaagttggat
gacaactctatccagttgtttggcccaggaattcagccccatcactgtgacctcaccaac
atggatggagtggtcactgtgacgcccagaagtatggacgcagaaacctacgtggaaggc
cagcgcatctcggaaaccaccatgctgcagagtggcatgaaagtgcagtttggggcgtcc
catgtatttaagtttgtggaccccagtcaggatcatgctcttgcaaaaagatctgtggat
ggaggcctgatggttaagggcccgagacataaacctggaattgttcaggagacaactttt
gatttgggaggagatattcatagtgagacagcattaccgacaagcaagagcaccactagg
ctggacagcgacagagtgtcgtctgcctctagcacagccgagcggggaatggtgaagccg
atgatcagagtagagcagcagccagattatcacaggcaagaaagcagaatgcaggatgct
tctgggcctgaactgatactacctgcaagcattgaattcagggaaagttctgaagattca
tttttgtctgccattataaattatactaatagctctacagtccactttaagttgtcccct
acatatgtattatatatggcatgccggtatgtattgtccaaccagtacagacctgacatc
agccctacagagcgcacacataaagtcattgcagtcgtcaacaagatggtgagcatgatg
gagggcgtcatccaggaagtagaccaggttgaccagaaacagaagaatattgcaggggca
cttgccttctggatggcaaatgcatctgaacttctcaacttcattaagcaagaccgagac
cttagtcggatcacattggatgctcaagatgttttagcacatttggttcaaatggcattt
aaatacttggttcactgtcttcaatcagaacttaataattacatgccagcctttctagat
gaccctgaagagaacagtctgcaaagaccaaaaatagatgatgtgctgcacacgctcaca
ggagccatgtccttgctacgacgctgcagagtcaatgccgccctgaccatccagctcttc
tctcagctcttccactttatcaatatgtggctgttcaatagattggtgactgacccagat
tcagggctgtgctcccattactggggtgcaattatccgtcagcagctgggccatattgaa
gcctgggctgagaagcaggggctggaactggctgcggactgtcacctgagcaggatcgtg
caggcaacgactttgcttaccatggataagtatgcacctgatgacattccaaatataaac
agcacctgctttaagttaaattcactacaacttcaagccttattacagaactatcactgt
gcacctgatgagccttttatcccaacggatcttatagaaaatgtagtggctgtggctgaa
aacactgctgatgagctggcccgcagcgatggaagggaagtgcagttggaggaggatcct
gatctgcagctgccatttcttttgccagaagatggttattcttgtgatgttgtcagaaac
attccaaatggtttacaagaatttttagaccctctgtgccagagaggattttgcaggtta
attcctcacacacgttcaccaggtacttggacaatatattttgaaggtgcagattatgaa
agtcaccttctgcgtgagaacacagagctggctcagcctctgaggaaagaacctgaaata
atcactgtgaccctaaaaaagcagaatggaatgggccttagcattgttgcagcaaagggt
gctggtcaagataaactaggaatctatgtgaagtcggttgtgaaaggaggtgctgcagat
gtggatggacgtctagctgcaggtgatcagctcctcagtgtggatggacgaagtctggtt
ggactctctcaggaaagggcagcagaactcatgacaagaacaagctctgtggtgacgctg
gaagtagcaaagcagggtgccatctaccacggtctggccacccttctcaatcagccatcc
cctatgatgcagagaatttcagatcgtcgtggctcaggtaaaccccgaccaaagagtgaa
ggctttgagctctataataattcaactcaaaatgggtctcctgagagtcctcagctgcct
tgggcagaatatagtgaaccaaagaaattgcctggtgatgacagactgatgaaaaataga
gctgatcaccgttccagccccaacgtagcaaatcagcctcctagtcctggagggaaaagt
gcatatgcccctggaacaacagcgaagataacatctgtctctactggaaacctctgcact
gaggaacagactcctccgcctagacctgaagcctaccccatccccactcagacgtacacc
agagagtattttaccttcccagcttccaaatcccaggatcggatggctcctcctcagaac
cagtggccaaattatgaggaaaagccacatgtgcacacagacagtaatcattccagtatt
gcaattcagcgtgttacacgttcccaagaagaacttcgagaagataaagcttaccaactt
gagcggcatcgaatagaggcagctatggaccgaaagtctgatagtgatatgtggataaat
cagagctcctcattggactccagtacctctagccaagagcatctgaaccattcctctaag
tcggtcacccctgcttccacactgaccaaaagtggccctggccgttggaaaacaccagca
gccataccggccacccctgtggccgtctcccagccaatccgaacagacctgcctccgcca
cccccgccacctcccgcccactatgccggtgatttcgatggaatgtccatggatttgcct
ctcccgccacccccttctgccaaccagatagggctgccgtctgcgcaggtggctgctgcc
gaacggaaaaagagagaagaacatcagcgttggtatgagaaggagaaggcccgcctggag
gaggagcgggagaggaagcggagagagcaggagaggaagttgggccagatgcgcactcag
tccttaaaccctgctccgttttctcccttgaccgcacagcagatgaagcccgaaaagcct
tccacactccagcggccccaggaaacagtcattcgggagctgcagcctcagcagcagccc
cgcacgatcgagcgcagagacttgcagtacatcacagtcagcaaagaggagctttcttca
ggggacagtctgtcccccgacccgtggaagcgggacgccaaggagaagctggagaagcag
cagcagatgcacatcgtggacatgctgagcaaggagatccaggagctccagagcaaaccg
gaccgcagcgccgaggagagcgaccggctgcgcaagctcatgctggagtggcagttccag
aagagactccaggagtcgaagcagaaggacgaagatgacgaggaggaggaggacgacgat
gtggacaccatgctgatcatgcagcgcctggaggctgaacgaagagcaaggttgcaggac
gaggagcggaggcggcagcagcagttagaagagatgcgcaagcgggaagcggaagaccga
gcgaggcaagaggaagagcgccggcggcaggaggaggagcgaacaaaacgagacgctgaa
gaaaagaggcgacaggaagaagggtattacagccgcctggaagctgagaggcgcagacag
cacgacgaggcggcgcgcaggttgctggagcccgaggcgcctggtctgtgccgccctccg
cttccccgggactacgagcccccgtccccgtcccccgcgcccggcgcccctcctcccccg
cctcagcgaaacgcctcctacctcaaaacacaggtcctctcccccgactcgctgttcact
gccaagtttgttgcatacaatgaggaggaggaggaggaggactgcagcctagcaggtcag
gataagtactccagcacaagaaagtctcatggggaccttcttcctgcccctcttaaacca
cggccacccccctgccagccacgcccggcctccgatggcatctttctctccaactcattc
cagctaccctcagccaaagccaacagtactgctcacaaaaaaggccagccctcgccccct
ccaaaaaaatccagctcctaccatcccagccactgcaaaggaccaaactcttacccagga
tctactggagcagctgttggagcccatgacgcctatcgggatgcaaaagagaagcgctct
aaaagccaggatgcagattcacctggaagttctggggcccctgaaaacttgacattcaag
gaacgccagcgtcttttttcacaaggtcaagatgtatccaataaagtgaaagcttctcgt
aaattaacagaactggagaatgaactgaacacaaagtga

DBGET integrated database retrieval system