KEGG   Pongo abelii (Sumatran orangutan): 100460337
Entry
100460337         CDS       T01416                                 

Gene name
STK11
Definition
(RefSeq) serine/threonine-protein kinase STK11 isoform X1
  KO
K07298  serine/threonine-protein kinase 11 [EC:2.7.11.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04068  FoxO signaling pathway
pon04140  Autophagy - animal
pon04150  mTOR signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04211  Longevity regulating pathway
pon04530  Tight junction
pon04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:pon00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100460337 (STK11)
   04151 PI3K-Akt signaling pathway
    100460337 (STK11)
   04152 AMPK signaling pathway
    100460337 (STK11)
   04150 mTOR signaling pathway
    100460337 (STK11)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    100460337 (STK11)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    100460337 (STK11)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    100460337 (STK11)
  09149 Aging
   04211 Longevity regulating pathway
    100460337 (STK11)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:pon01001]
    100460337 (STK11)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100460337 (STK11)
Protein kinases [BR:pon01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100460337 (STK11)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Pkinase_fungal Kdo
Other DBs
NCBI-GeneID: 100460337
NCBI-ProteinID: XP_024092349
LinkDB
Position
19
AA seq 507 aa
MEVVDPQQLGMFTEGELMSVGMDTFIHRIDSTEVIYQPRRKRAKLIGKYLMGDLLGEGSY
GKVKEVLDSETLCRRAVKILKKKKLRRIPNGEANVKKEIQLLRRLRHKNVIQLVDVLYNE
EKQKMYMVMEYCVCGMQEMLDSVPEKRFPVCQAHGYFCQLIDGLEYLHSQGIVHKDIKPG
NLLLTTGGTLKISDLGVAEALHPFAVDDTCRTSQGSPAFQPPEIANGLDTFSGFKVDIWS
AGVTLYNITTGLYPFEGDNIYKLFENIGKGSYAIPGDCGPPLSDLLKGMLEYEPAKRFSI
RQIRQHSWFRKKHPPAEAPVPIPPSPDTKDRWRSMTVVPYLEDLHGADEDEDLFDIEDDI
IYTQDFTVPGPRRGGQSEWTEPGPPQGRVYERHRGGAAEHQIQGGGPGPQPCPQGLLRQQ
QDPPAVGLQAAVRVAACSPCPGAPPGARARPSSVFLPVPPALPERWPPCFCADHAPGPPE
HPAGPGRGTAGTGRSPPLGRPAVHAAC
NT seq 1524 nt   +upstreamnt  +downstreamnt
atggaggtggtggacccgcagcagctgggcatgttcacggagggcgagctgatgtcggtg
ggtatggacacgttcatccaccgcatcgactccaccgaggtcatctaccagccgcgccgc
aagcgggccaagctcatcggcaagtacctgatgggggacctgctgggggaaggctcttac
ggcaaggtgaaggaggtgctggactcggagacgctgtgcaggagggccgtcaagatcctc
aagaagaagaagttgcgaaggatccccaacggggaggccaacgtgaagaaggagattcaa
ctactgaggaggttacggcacaaaaatgtcatccagctggtggatgtattatacaacgaa
gagaagcagaaaatgtatatggtgatggagtactgcgtgtgcggcatgcaggaaatgctg
gacagcgtgccggagaagcgtttcccggtgtgccaggcccacgggtacttctgtcagctg
attgacggcctggagtacctgcacagccagggcattgtgcacaaggacatcaagcccggg
aacctgctgctcaccaccgggggcaccctcaaaatctcggacctgggcgtggccgaggca
ctgcacccgttcgcggtggatgacacctgccggaccagccagggctccccggctttccag
ccgcccgagattgccaacggcctggacaccttctccggcttcaaggtggacatctggtcg
gctggggtcaccctctacaacatcaccacgggtctgtaccccttcgaaggggacaacatc
tacaagttgtttgagaacatcgggaaggggagctacgccatcccgggcgactgtggcccc
ccgctctctgacctgctgaaagggatgcttgagtatgagccggccaagaggttctccatc
cggcagatccggcagcacagctggttcaggaagaaacatcctccagctgaggcaccagtg
cccatcccaccaagcccagacaccaaggaccggtggcgcagcatgactgtggtgccgtac
ttggaggacctgcacggcgcggacgaggacgaggacctcttcgacatcgaggatgacatc
atctacactcaggacttcacggtgcccggtcccagaagaggaggccagtcagaatggaca
gagccggggcctccccaaggccgtgtgtatgaacggcacagaggcggcgcagctgagcac
caaatccaaggcggagggccgggcccccaaccctgcccgcaaggcctgctccgccagcag
caagatccgccggctgtcggcctgcaagcagcagtgagggtggccgcctgcagcccgtgt
ccaggagccccgccaggtgcccgcgccaggccctcctcagtcttcctgccggtcccgccc
gccctcccggagaggtggccgccatgcttctgtgccgaccacgccccaggacctccggag
caccctgcagggccgggcagggggacagcagggaccgggcgcagccctcccctcggccgc
ccggcagtgcacgcggcttgttga

DBGET integrated database retrieval system